KEGG   Coccidioides immitis: CIMG_07735Help
Entry
CIMG_07735        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K03964  
NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 8
Organism
cim  Coccidioides immitis
Pathway
Oxidative phosphorylation
Metabolic pathways
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:cim00190]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 155 aa AA seqDB search
MLIRILTAKLPVQACARLPSVARPAFTQVRYASQAEIEDPGMNGGYPNPPAQRRQFRDPY
GGWWDPQDRRNFGEPVHEDNDILGTFTTESYTHFKAPKAFFLMGCAITTVFAFSGLVSLF
YPDKPSVPRTFEDGLEKELGGANAVRARKPGEDSW
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgcttatacggattttgacggcaaaattgccggtgcaggcttgtgccagactaccttcg
gttgcccgccctgccttcacgcaagttcgatatgcctcccaggctgagattgaagatccc
ggaatgaatgggggttatcccaatcctcctgctcagagacgccaattccgcgatccttac
ggcggttggtgggatccacaggatagaaggaacttcggagagccggttcacgaagataac
gatatccttggcacattcactaccgagtcatatacccatttcaaagctccaaaggcattc
ttcttgatgggctgcgctatcaccactgttttcgctttcagcggccttgtcagccttttc
taccctgacaagcccagcgttccccgtacgtttgaggacggccttgagaaggagttaggg
ggtgcaaatgcagttagggcccgaaaacctggcgaagactcatggtag

DBGET integrated database retrieval system