KEGG   Coccidioides immitis: CIMG_07885Help
Entry
CIMG_07885        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
cim  Coccidioides immitis
Brite
Enzymes [BR:cim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CIMG_07885
Protein kinases [BR:cim01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   CIMG_07885
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 813 aa AA seqDB search
MTSSPTATPLTREYIDPDTPMEDADPYNRSKYPTRSSQQNRPSSQYLSSEESSVARKYSP
MNITSPAVPYNASPNTSQGSYSFQAAGAPSRPQAPRLPPMQTTDISPEQYYPQSATLQLH
TAFGQNSKTQPARPSHLNQSSSALETSARRGPVPRFQKIKSTQELKPKVNAQPAFRRANP
EGGFISPLQALTTHLPATYRICNPTFKYESSRNPRRVLTKPSKGTKNDGYDNDDSDYILY
VNDILGSEEANHKNRYLILDVLGQGTFGQVVKCQNLKTQEVVAVKVVKNRTAYFNQSMME
VSVLDLINSKLDKNDDHHLLRLKDTFIHRQHLCLVFELLSVNLYELIKQNQFRGLSTTLV
RVFAQQLLNGLALLNKARLIHCDLKPENILLKNLESPIIKIIDFGSACDERQTVYTYIQS
RFYRSPEVLLGLPYSSAIDMWSLGCIVVELFLGLPLFPGSSEYNQVSRIVEMLGMPPTWM
IEMGKQAGEFFEKTQDEFGRRSYRLKSLEQYSREHNTKEQPSKRYFQSNNLSEIIRNYAM
PRKNMKQAEIDRELNNRVAFTDFVRGLLTINPLERWSPQQAKLHPFITQQKFTQPFVPPM
NLKSSVINKSVAPGVQQQQQAEAASKQRAAQEAQVHAQAQSAAQSAYAMQMNPYNPASHS
QPPTVYNNMYAGHQQGAPPPYPAQQSGYGHQMGMMQSPSHIPQQPYGASQSLYAQATTRA
GRQRASTMDQQQSGIPPAIQRVASHLDPNAPIRLQPSPAYYPPPADGYSEGNASGTRRRG
SRVGGNHGRGRDFIRTLEDGALGDGFMAQNQWR
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgtcgcccactgcgaccccgcttacgcgggagtatatcgacccggatacgccg
atggaagatgcggatccgtataataggtcaaaatatcccaccaggtctagccagcagaac
cgaccctcttctcaatatctttcgagtgaggagtcctcggttgccaggaaatactcccca
atgaacatcacttcgccggcagtcccctataacgccagtccaaacacttcgcaaggttca
tactccttccaagcagctggtgctccatcgagacctcaagctccacgattacccccgatg
caaaccacggatatcagtccggaacagtactacccgcaatcggccaccctccaactccac
acggcattcggacagaactcaaaaacgcaacccgcccgaccgtcgcacttgaaccaatcg
agctccgccttggaaacgtcggctagaaggggccctgtgcctagatttcaaaagatcaag
tccacgcaagagctgaagccgaaagtaaatgcgcagcctgcctttcgtcgtgcaaatccc
gagggggggttcatcagccctctccaagctctcacaacgcatttacccgccacgtaccga
atatgtaacccaacgtttaaatacgaatcgtccaggaatccccgacgagtgctaacaaag
cccagcaagggaaccaagaatgatggctatgacaatgatgacagtgactatatcctctat
gtcaatgacattcttggcagtgaggaggcaaatcataagaaccggtaccttattcttgat
gtgcttggacaaggcacgtttggtcaggtggtgaagtgccagaacttgaagacccaagaa
gttgttgctgtcaaggttgtgaaaaatcggacagcatattttaatcagagcatgatggaa
gtctcagttcttgacctgatcaatagtaagctggacaagaacgatgatcaccatcttttg
cgcctaaaagataccttcatacatcgacaacatctatgcctggtttttgagcttctaagt
gtgaatctctatgaactcatcaaacaaaatcaattccgtggacttagcacaacattagtt
agggtttttgcgcagcaacttctaaatgggttagcattactcaacaaagctcggctcatt
cactgtgacctcaaaccggaaaatattcttttgaaaaacctcgaaagtccaatcatcaag
atcatagattttggttctgcttgtgatgaaaggcagacagtctatacttatattcaatcc
cgattttatcgttcacctgaagttcttttaggccttccatattcatctgctattgacatg
tggtcattaggttgtattgttgttgagcttttccttggtttgccattatttccgggatcc
tccgagtacaaccaggtttctagaatagtagaaatgctgggcatgccgccaacatggatg
atcgagatgggaaagcaagccggcgaattctttgaaaaaacccaagatgaatttgggaga
cgaagttataggcttaaaagccttgaacagtactcgcgtgagcacaacaccaaggagcag
ccgagcaagagatatttccagtcgaacaacttgagtgaaatcattcgtaactatgccatg
ccaaggaagaatatgaagcaagcagaaattgatagagagttgaacaatcgcgttgcattt
actgattttgttcgtggactattgacaatcaatcccctagaaaggtggtcgccgcagcaa
gcaaagttgcaccctttcattactcagcaaaaatttacacagccatttgtgccgcctatg
aacttgaaatcctctgttatcaacaaatctgttgcgcccggtgttcagcagcagcaacaa
gctgaggccgctagcaaacaacgtgcggcacaagaggcacaagtacacgcacaggcccaa
tctgcagctcagtctgcatatgcaatgcaaatgaatccatataacccggcttctcacagc
caacctccgacagtgtataataacatgtacgctggtcatcaacaaggtgctccaccccct
tatccggcgcagcaatcaggatatggacaccagatgggaatgatgcaaagtccttctcat
attccgcaacaaccatatggagcctcccagagcctttatgcccaagcaacaacgagagct
ggacgacaaagagcttccactatggatcagcaacagagtggtatccctcctgcgattcag
agggttgccagtcatttagatccaaatgctccgattcgcttgcaacccagcccagcttat
tatcctccaccggcggatggatattctgaaggaaatgcatctgggacgcgtcggagaggc
agccgtgtcggtggaaaccatggtcggggtcgagattttattcgcaccctcgaagacggt
gcacttggtgatggatttatggcccaaaatcaatggcgatga

DBGET integrated database retrieval system