KEGG   Coccidioides immitis: CIMG_08092Help
Entry
CIMG_08092        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
cim  Coccidioides immitis
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:cim03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 241 aa AA seqDB search
MAAAVAGNVVAPVADENIPPNGVESEIKKDEEITVFHDPNNFNVKHPLMNEWTLWFTKPP
SGKGDNWNDLLKEVVTFNSVEEFWGVYNNITPTSELGLKADYHLFKKGVRPEWEDQQNKH
GGKWSFQFKDKRSVPIDELWLHSQLAAIGETLENDGDNEVMGVVVNVRKGFYRIGLWTRT
VGKLIPGSDGRSAEKSQEILKAIGRRFKEVLRLKDTDQLEFSGHTDSAQSGSTRAKAKFV
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgcagtcgcaggaaatgttgttgctcctgtagcagatgagaacatccctcca
aatggagtcgaatctgagattaagaaggatgaagagatcacagttttccacgacccaaat
aatttcaatgtgaagcacccccttatgaatgagtggacactctggttcaccaaaccacca
agtggcaagggtgataactggaacgatcttttgaaggaggttgtaacatttaactctgtc
gaggaattctggggagtctataacaacataacaccaacctccgaacttggtctaaaagcc
gattaccaccttttcaagaagggcgtccgaccagaatgggaggaccagcagaacaagcat
ggcggcaaatggtcatttcagttcaaagataagcgcagtgtccctatcgatgaactctgg
ctccactctcaacttgccgctattggcgagacgcttgagaacgatggcgacaatgaagtt
atgggtgttgtggtgaatgtgcgcaaaggcttctaccgtattggtctttggacaagaact
gttggcaagttaattccgggttctgatggtcgttccgctgagaaaagtcaagaaattttg
aaggcaattggacgacgattcaaggaggtattgagactgaaagacacagatcagttggaa
ttttctggccataccgatagcgcccaatcgggaagtacgagagccaaagcgaagtttgtg
gtttga

DBGET integrated database retrieval system