KEGG   Coccidioides immitis: CIMG_08158Help
Entry
CIMG_08158        CDS       T01114                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cim  Coccidioides immitis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CIMG_08158
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CIMG_08158
Enzymes [BR:cim01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CIMG_08158
Lipid biosynthesis proteins [BR:cim01004]
 Desaturase
  First
   CIMG_08158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 462 aa AA seqDB search
MAAPAVAADASKARPAGADIKKPHITETPMTWSNWHKHVNWLNVTLILLIPLYGCVQAFW
VPLQLKTAIWAIAYYYMTGIGITAGYHRLWAHCSYSATLPLRIYLAAVGGGAVEGSVRWW
ARDHRAHHRYTDTDKDPYSVRKGLLYSHIGWMIMKQNPRRIGRTDITDLNEDPVVVWQHR
NYLKVVITMGLIVPMLVSGLGWGDWWGGFIYAGILRIFFVQQATFCVNSLAHYLGEQPFD
DRNSPRDHVMTALITMGEGYHNFHHEFPSDYRNALEWYQYDPTKWIIWVWKQVGLAYDLK
QFRANEIEKGRLQQLQKKIDQRRAKLDWGIPLEQLPVMEWDEYVEQAKNGRGLIAVAGVV
HDVTDFIKDHPGGKAMINSGIGKDATAMFNGGIYNHSNAAHNLLSTMRVGVIRGGCEVEI
WKRAQQENKDVEFVRDANGKRIIRAGEQVTKLPEPVPSAGAA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctgccccagccgtggctgcagatgcctccaaggctcgccctgccggtgctgatatc
aagaagcctcatatcacagagacgccaatgacctggtcgaactggcacaagcatgttaac
tggctgaacgtcacgctgatccttctcattcctctgtatggttgtgttcaagcgttctgg
gttcccctccagctcaagaccgctatctgggctattgcgtattattatatgaccggtatt
ggtatcaccgctggttaccatcgtctttgggctcactgctcgtattctgccacccttccc
ttgagaatctacctggctgccgttggaggaggtgccgtcgaaggatcggtcagatggtgg
gctcgtgatcaccgtgcccaccaccgctatacggataccgacaaggacccttactccgtc
cgcaagggtctcctgtactcccacattggctggatgatcatgaagcagaatccaagacgt
attggccgcactgacatcaccgatctcaacgaggacccagtcgtcgtctggcagcacaga
aactacctcaaggtcgtcatcacaatggggttgattgttcctatgcttgtcagtggactc
ggatggggagactggtggggtggtttcatctatgctggtatccttcgaatcttctttgtc
cagcaggctaccttctgcgtcaactccttggcccattacctgggagaacagcccttcgat
gaccgcaactctccccgtgaccacgttatgactgccttgatcaccatgggtgaaggttat
cacaacttccaccacgaattcccttctgactaccgcaacgccctcgaatggtatcagtat
gacccaaccaaatggatcatctgggtttggaagcaagtcggactcgcatacgacttgaag
cagttccgagccaacgaaatcgagaagggacgcctccagcagctccagaagaagatcgac
caaagacgtgctaaactcgactggggtattcctcttgaacagttgccagtcatggaatgg
gacgagtacgtcgagcaggccaagaatggtcgtggccttattgccgtcgcaggagtcgtc
catgacgttaccgatttcatcaaggatcacccaggtggtaaggccatgatcaactccggt
attggcaaggacgcaaccgccatgttcaacggtggtatttacaatcactccaacgccgcc
cacaacctcctgtcaacgatgcgtgtcggtgttatccgaggtggctgcgaagtcgagatc
tggaagagagcccagcaggaaaataaggatgtcgaattcgtccgtgacgctaatggaaag
agaatcattcgtgcgggcgagcaagtgaccaagctccccgagccagtcccaagcgccggc
gctgcctaa

DBGET integrated database retrieval system