KEGG   Coccidioides immitis: CIMG_08209Help
Entry
CIMG_08209        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cim  Coccidioides immitis
Brite
Enzymes [BR:cim01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CIMG_08209
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 373 aa AA seqDB search
MASAARTLTRAFARATPATSSARSSVTRSSLRFSAPAYTFRASSRRGYSSGAEGGKSSSG
LIWGLAAVAAGGAGAFYYLNGDHLSSNSAKPTIISDPTKEDFQKVYDEIARLLVEKDDYD
DGSYGPVLVRLAWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKAARDFLEPVKKK
FPWISYSDLWTLAGSCAIQELGGPDIPWRPGRKDADMTACTPDGRLPDASKDQKHIRAIF
GRMGFDDREMVALCGAHALGRAHSDRSGYDGPWDFSPTVFTNEFFKLLLDEKWVQKKWNG
PKQFTDNTTKTLMMLPTDMALIKDKEFKKHVDRYAKDSDVFFKEFSDVFVKLLELGVPFT
SKAEDRYVFKRSE
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgctgcgcgaactctcaccagagcttttgctcgagccaccccagcaacctct
tctgctcgatcttcagtcacccgtagctcacttcgcttctctgctcccgcctatactttc
cgcgcgtcgtctcgcaggggctactcctccggcgctgaaggtggaaagtcgtcctctggc
ctcatctggggtcttgcagccgttgccgctggtggtgccggtgctttctactacttgaac
ggtgaccacctgtcgtcgaattcggcgaaacctactatcatctccgacccaaccaaggag
gacttccagaaggtttatgatgaaattgcaagacttcttgtagagaaggacgattatgat
gatggaagctacggacctgtccttgttcgtctcgcctggcacgccagtggtacctacgat
aaggaaactgggactggaggaagcaatggcgctaccatgcgcttcgccccagagtctgac
cacggtgccaatgctggattgaaggctgctagagatttcctcgaaccagtaaagaagaaa
ttcccttggatttcttactccgatctctggacccttgctggttcttgtgccatccaggag
ttgggaggacctgacatcccatggcgccccggccgcaaggacgctgatatgactgcctgc
acacctgatggtcgtcttccagatgcctccaaggatcagaagcacatcagagctatcttc
ggtcgtatgggtttcgatgatcgcgagatggtcgctctttgcggtgctcacgctctcggc
cgtgctcacagcgaccgatccggctatgatggaccatgggacttcagccctaccgtattc
accaatgaattcttcaagttgcttttggacgagaaatgggtccagaaaaagtggaacggc
cctaaacagttcaccgacaacaccaccaagaccttgatgatgcttccaacggatatggct
ttgattaaggataaagaattcaagaaacacgtcgaccgatacgccaaggatagcgatgtc
ttcttcaaggagttctccgatgtattcgtcaagctccttgagctgggcgtgcctttcacc
tccaaggctgaagaccgctacgtcttcaagagaagcgagtaa

DBGET integrated database retrieval system