KEGG   Coccidioides immitis: CIMG_08300Help
Entry
CIMG_08300        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
cim  Coccidioides immitis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CIMG_08300
Enzymes [BR:cim01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CIMG_08300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 717 aa AA seqDB search
MRPIGAAVNALLTAALLAGTAGASAIPLDSDVHIRALPNAPNGYTPANVPCPANRPTARS
AATVSPDEARWLEKRRKKAMSALAGFFGHVFIPDFDAVAYIGKYAENLAQLPNIGIAVSG
GGYRALMNGAGAIKAFDSRTAGSTSKGHLGGLLQSATYLSGLSGGGWLVGSLYLNNETSV
DALTSGMEGKAWDFHRSIFQGPKFTSSTFLDILRYYAQLQSAVAGKQDAGYKVSITDYWG
RALSYQFINAKEGGPSYTWSSISLSSDFQNAEYPMPIILADGRNPGEKLILGNATVFEFN
PWEFGTFDPTIFGFVPLEYLGSKFQAGVLPSSESCVRGFDNAGYIMGTSSSLFNEFALRL
DEVDIPKFIKDELRKILKALGDENNDIADYSPNPFYQYATGTSPFAGVLSLPLVDGGEDG
QNIPLHPLIQPARNVDVIFAIDSSANTKNNWPNGSSLVATYQRSLDPSGIANGTSFPAVP
DVNTFVNLGLNTRPTFFGCDSSNTTKPTPLVVYIPNYPYTTFSNISTFTLATPNETRDAI
IKNGYDVATMGGGTGEKEWPTCVGCAILSRSFERTGTAIPAACQECFKKHCWDGTVNSAT
PADYAPSVGPPSAGAKSAASARIRASPILWIVSPLGRPYAKTSQIAHSSYPLPRQPLNGD
KQQTQTRLSAKRPTTSLNAHLQISSSPAVHVATVASMLLVLSFSITPFSMLESPESG
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgagacctatcggggccgctgtcaatgccctcctaacagcagctctgcttgcaggcacg
gctggggcatccgcaattccattggattcagacgtacatatccgagctctgcctaatgct
ccgaatggctatactcccgcgaatgtgccttgtcccgccaatcgtccgaccgctcggagt
gccgccaccgtttctccggacgaagcccgttggctggagaagagaaggaagaaggccatg
tcggcactggctggcttcttcggtcatgtattcatccccgattttgatgcagtggcctat
atcgggaagtatgccgaaaatcttgctcagctgccgaacattgggatcgccgtgtctgga
ggaggatatagagccttgatgaatggtgccggcgccataaaggcgtttgactctcgtacc
gcgggttcgacatctaaaggtcacctcggtggtcttcttcagtcggcgacctatttatca
ggtttgagtggcggaggatggttggtcggctctctgtatttgaataacgagacatccgtg
gatgccttgacaagtggcatggagggaaaggcatgggactttcaccgttctatctttcag
ggccccaaattcaccagttccactttcctagacatcctccggtactacgcgcagcttcaa
agcgccgtggctgggaaacaagacgccggatataaagtttctattacggattactggggg
cgcgctctctcctaccagtttatcaatgcaaaagaaggtggtccttcatatacgtggtct
tcgatctcactgagctcagatttccagaatgctgaatacccaatgccaatcattctcgcc
gatggacggaacccgggagagaagcttatcctcggaaatgctactgtattcgagtttaat
ccgtgggagttcggtacttttgatccaacaattttcggcttcgtccctcttgagtatctt
ggctccaagtttcaagctggggtccttcctagcagcgaatcgtgtgtccgcggctttgac
aatgctgggtatataatgggcacctcttcttcactctttaatgaatttgcccttcgtctg
gacgaggtcgacatacccaagttcatcaaagatgagctacggaagattctgaaggccctt
ggagacgaaaataatgacatcgcagactatagccccaacccgttctatcaatatgcgact
gggacatctccgttcgctggcgtgctatctctcccccttgttgacggtggagaggatggt
caaaatatccctcttcatccgctaattcagccggcgagaaatgttgacgtgatctttgcc
atcgactcttctgcaaataccaagaacaattggccaaacggaagttccctagtagctact
tatcagagaagtttggacccgtctggaattgccaacggaacatcgttccctgcagtgccg
gacgtaaacacatttgtgaaccttgggctaaatacgaggcccacattcttcggctgcgat
agctcgaacaccaccaagcctacccctctcgttgtttatattccaaactatccgtacacg
accttctctaacatttccacctttaccctagctaccccgaatgagactcgggatgcaatc
atcaaaaacggctatgatgtggctaccatgggcggcggcaccggagaaaaggagtggccc
acctgcgttggatgcgctatcttgagtcggtcgtttgagaggacaggcaccgcgattccg
gctgcctgccaggaatgcttcaagaaacattgttgggatggaactgtcaatagcgccact
ccggcggactatgccccgagtgtgggaccacccagcgcaggtgcaaagagcgccgcatct
gccaggattcgcgcctctccaattctatggatcgtgagccccctagggcgaccctacgcc
aagaccagccagatcgctcactctagttatccgttgccccggcaaccgctgaacggcgac
aaacaacaaacacaaactcggctttcggcgaaacgaccgacgacgtcgctcaacgctcac
ctccagatctccagctctccagctgtccacgtcgcaactgttgcatctatgctacttgtt
ctatccttcagtataactccatttagtatgctcgaaagcccggaatccggttga

DBGET integrated database retrieval system