KEGG   Coccidioides immitis: CIMG_08305Help
Entry
CIMG_08305        CDS       T01114                                 

Definition
(RefSeq) glucose-6-phosphate 1-epimerase
  KO
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cim  Coccidioides immitis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CIMG_08305
Enzymes [BR:cim01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CIMG_08305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 313 aa AA seqDB search
MDRSNKPAAIPVTSSLPQPSVTVQDGRVEASLASGESVTVHLFGATVTSWKLANGHELLF
LSEKAHLDGSKPIRGGIPLVFPVFGPPPQNHATSALPQHGFVRNSSWELLGKSTSESESG
ASVKLDFGLSNSMLSDKFKGDWPYEFGLVYSVTLSKRSLETSLRVQNEGLKSFEFQTLLH
SYFKVEDISKIRVQNLQSKTYVDKVRNAEIFTESSPALAVEGEVDRVYQSLDPKVPIVIA
SESDKPIFSITRESLNDVVVWNPWIEKAKGMADFAPDEAYKNMICVEAGSVVGWQTLEPG
DTWEGGQTIECKL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaccgttcaaacaagcccgctgccattccagtcacctcctctctcccgcaaccgtcg
gtcaccgttcaggacgggagggtagaggcctcgctggcttcgggggaatcagtcacagtt
catctctttggagccacagtcacctcatggaagcttgccaacggacacgagctactgttc
ctgagtgaaaaggcccatctggacggctcaaaacctattcgtggtggaattccactggtc
ttccccgtgtttggacctcctccgcagaatcatgccacgtccgcccttccacaacacggc
ttcgtgcgtaattcctcatgggaattgcttggtaaatctacatccgagtcagagagcgga
gcaagcgttaagcttgactttggcctctcaaactctatgcttagcgacaagttcaaaggc
gactggccctatgaatttggcttggtctacagcgttactttgagcaaacgaagcctggag
acctcattacgggtacagaacgagggcttgaaatcgtttgaatttcagacactgctgcat
tcttactttaaggtcgaggatatctccaaaattcgagtccagaaccttcagtcgaaaaca
tacgttgataaagtccggaacgctgagattttcacagaatcatccccggcactcgcagtt
gaaggggaggtagaccgggtctatcagtctctggaccccaaagtgccaatagttatagcg
tcggaatctgacaagccgatcttctctattacccgtgagtcgctgaatgacgtcgttgtg
tggaacccgtggattgaaaaggccaagggaatggccgattttgctcctgacgaagcatat
aaaaatatgatctgtgttgaggcgggatcggtagtcggttggcagacccttgagccgggt
gatacctgggaaggtggacagacaattgagtgcaaattatag

DBGET integrated database retrieval system