KEGG   Coccidioides immitis: CIMG_08631Help
Entry
CIMG_08631        CDS       T01114                                 

Definition
(RefSeq) transcription factor Tfb2
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
cim  Coccidioides immitis
Pathway
cim03022  Basal transcription factors
cim03420  Nucleotide excision repair
Module
cim_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cim00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CIMG_08631
  Replication and repair
   03420 Nucleotide excision repair
    CIMG_08631
Transcription machinery [BR:cim03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CIMG_08631
DNA repair and recombination proteins [BR:cim03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     CIMG_08631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tfb2 Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 4560341
NCBI-ProteinID: XP_001241468
UniProt: J3K5W9
AA seq 487 aa AA seqDB search
MPVSSSRPLEYLESLPGTVFLKLYQQPSTALAIFRRMLPHLAKCFVMALLYLKDPLPAAE
LELWVKAGSKRERDNALSILSRLHILSSTTTSDHVRAYMVTNPFSSSLRQALTGGDKQHS
FGVMSSMPDPHPMTVSDLDDYARRQWEGVLGYMVGTNSLGIQRENVTLSKGVKSLLQACH
LVEVRDRRVEITKEGFAFVLQDVNTQVWHILILYVENAEAIGMDSVEVLSFLFLLSSLEL
GQSYDKKHLTSTQLRTLADLTDFGIVYQHSPASESTRFYPTRLATTLTSDSMALSSSISG
NLAPAGPNINAATGAPGTGFIIIETNYRLYAYTSSPLQISLIALFTTLKYRFPNLVTGKL
TRQSIRRAVEMGITADQIISYLTTHAHPQMRKVNASKSTSTTAGLLASVLPPTVVDQIRL
WQLERDRLKATPGFLFKDFASSAEFEAPCRYAEEIGVLVWKSEKRRMFFVTRHEQVAAFL
RSRASRS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtttcttcgtcccgtcctctagagtatctagagagccttccgggcacagtcttc
ctcaagctgtatcagcagccttcaaccgctctggcaatctttcgccggatgctgccccat
ctagcaaaatgttttgtcatggcccttctctacctcaaagaccccctgccagcagctgag
ctcgagctgtgggtcaaggcaggaagcaagcgcgagagagacaacgccctgtcgatcctt
agtcgattacacattctttcaagcactacaacgtcggaccacgttagggcgtatatggtg
accaatccattttcctcctctctgcgacaggcgctcaccggcggagacaaacaacattct
tttggagttatgtctagtatgcctgatccgcaccctatgactgtctccgatctagacgat
tatgccaggcgacagtgggagggtgttcttgggtacatggtcgggacaaactcgctgggc
attcaacgtgaaaacgtaacgctgagtaaaggagtcaaatccctcctccaagcctgccac
cttgtcgaggtccgagatcgcagagtggaaatcaccaaggaagggtttgcctttgtattg
caagatgtcaatactcaggtctggcatattctcatcctctacgtcgagaacgccgaagcc
atcggaatggatagcgtcgaggtgctctcctttctcttcctcctcagtagcttggagcta
gggcaatcctacgacaaaaagcatctaacttcaacgcaactccgtacccttgccgacctc
actgatttcggaatcgtttaccaacattcccctgcttcggaatccacacgcttttaccct
actcgattggcaacaacgcttacatccgactccatggctctctccagctcgatctcaggc
aaccttgctccagctggtccaaacataaacgccgctactggtgcgccaggcacaggattc
ataatcatcgaaacaaactaccgcttatacgcgtatacctcttcccctcttcaaatttcc
ctcatcgcactcttcacaacacttaaataccgctttcccaaccttgttacgggaaagcta
acacgccaatccatccgtcgcgccgtcgaaatgggcatcactgccgaccaaataatatct
tacctcacgacccatgctcacccccagatgcgaaaagtaaacgcatcaaagtccacttca
accacagctggacttcttgcgtctgttctaccgcccacagtcgttgatcaaatccggctc
tggcagttagaacgtgataggctgaaggccacaccaggatttttgttcaaagatttcgca
tcttcggcggagtttgaagccccgtgccggtacgcagaggaaatcggtgttttagtttgg
aaatcagagaaacgaagaatgttctttgtcacgagacatgagcaagtcgccgcttttttg
agaagtagagcctctagaagttga

DBGET integrated database retrieval system