KEGG   Coccidioides immitis: CIMG_08631Help
Entry
CIMG_08631        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
cim  Coccidioides immitis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cim00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CIMG_08631
  Replication and repair
   03420 Nucleotide excision repair
    CIMG_08631
Transcription machinery [BR:cim03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CIMG_08631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 487 aa AA seqDB search
MPVSSSRPLEYLESLPGTVFLKLYQQPSTALAIFRRMLPHLAKCFVMALLYLKDPLPAAE
LELWVKAGSKRERDNALSILSRLHILSSTTTSDHVRAYMVTNPFSSSLRQALTGGDKQHS
FGVMSSMPDPHPMTVSDLDDYARRQWEGVLGYMVGTNSLGIQRENVTLSKGVKSLLQACH
LVEVRDRRVEITKEGFAFVLQDVNTQVWHILILYVENAEAIGMDSVEVLSFLFLLSSLEL
GQSYDKKHLTSTQLRTLADLTDFGIVYQHSPASESTRFYPTRLATTLTSDSMALSSSISG
NLAPAGPNINAATGAPGTGFIIIETNYRLYAYTSSPLQISLIALFTTLKYRFPNLVTGKL
TRQSIRRAVEMGITADQIISYLTTHAHPQMRKVNASKSTSTTAGLLASVLPPTVVDQIRL
WQLERDRLKATPGFLFKDFASSAEFEAPCRYAEEIGVLVWKSEKRRMFFVTRHEQVAAFL
RSRASRS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtttcttcgtcccgtcctctagagtatctagagagccttccgggcacagtcttc
ctcaagctgtatcagcagccttcaaccgctctggcaatctttcgccggatgctgccccat
ctagcaaaatgttttgtcatggcccttctctacctcaaagaccccctgccagcagctgag
ctcgagctgtgggtcaaggcaggaagcaagcgcgagagagacaacgccctgtcgatcctt
agtcgattacacattctttcaagcactacaacgtcggaccacgttagggcgtatatggtg
accaatccattttcctcctctctgcgacaggcgctcaccggcggagacaaacaacattct
tttggagttatgtctagtatgcctgatccgcaccctatgactgtctccgatctagacgat
tatgccaggcgacagtgggagggtgttcttgggtacatggtcgggacaaactcgctgggc
attcaacgtgaaaacgtaacgctgagtaaaggagtcaaatccctcctccaagcctgccac
cttgtcgaggtccgagatcgcagagtggaaatcaccaaggaagggtttgcctttgtattg
caagatgtcaatactcaggtctggcatattctcatcctctacgtcgagaacgccgaagcc
atcggaatggatagcgtcgaggtgctctcctttctcttcctcctcagtagcttggagcta
gggcaatcctacgacaaaaagcatctaacttcaacgcaactccgtacccttgccgacctc
actgatttcggaatcgtttaccaacattcccctgcttcggaatccacacgcttttaccct
actcgattggcaacaacgcttacatccgactccatggctctctccagctcgatctcaggc
aaccttgctccagctggtccaaacataaacgccgctactggtgcgccaggcacaggattc
ataatcatcgaaacaaactaccgcttatacgcgtatacctcttcccctcttcaaatttcc
ctcatcgcactcttcacaacacttaaataccgctttcccaaccttgttacgggaaagcta
acacgccaatccatccgtcgcgccgtcgaaatgggcatcactgccgaccaaataatatct
tacctcacgacccatgctcacccccagatgcgaaaagtaaacgcatcaaagtccacttca
accacagctggacttcttgcgtctgttctaccgcccacagtcgttgatcaaatccggctc
tggcagttagaacgtgataggctgaaggccacaccaggatttttgttcaaagatttcgca
tcttcggcggagtttgaagccccgtgccggtacgcagaggaaatcggtgttttagtttgg
aaatcagagaaacgaagaatgttctttgtcacgagacatgagcaagtcgccgcttttttg
agaagtagagcctctagaagttga

DBGET integrated database retrieval system