KEGG   Coccidioides immitis: CIMG_08886Help
Entry
CIMG_08886        CDS       T01114                                 

Definition
(RefSeq) lysophospholipase NTE1
  KO
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
cim  Coccidioides immitis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CIMG_08886
Enzymes [BR:cim01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CIMG_08886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1575 aa AA seqDB search
MNLTTTMPAAVAPDPPAQLAVSSRSLSDSSDAAGASRTSSSCRASSPSHCPTHAWNPDPP
PSSLQPVFSFSPSLPPPCPSPAISSCPPNTLSPPNLLQGIVSQLAMASYIGRLLLYLFQV
VPSLLYWAITFTTITVPTALFTLFSMSLTFTMNFTTLLIIVLLLVSTVSWFIRYRFLNIY
SRLPPEPQRKEPEIDLFPDSQDGDSKPGLSNYLDEFLSAIKVFGYLERPVFHELTRTMQT
RKLIAGETLLLEEEKGFCLVVDGLVQIFVKSIQERDDDRDGWQLDEAVEDSVDEDDEIRR
RGHQGYQLLTEVKNGASMSSLFSILSLFSEDIKLRHNEDMESSSSSFNNVPAPDSNPMSP
ALLLESPTRVSFPDQRDIPTQPSADTLPKVSPLALEGSPGPFEHDPKPRGHRRKRPSRPK
RAKSVHPDILARAMVDTTIAIIPASAFRRLTRVYPKATAHIIQVILTRLQRVTFATAHSY
LGLTTEVLSIEQQMTKYTSFDLPNHLRGAALDKLKSKFTKEKERLGPEDGTKGIALHNPA
LNRRRRSSSSLRKDAALHAKLTAVRGKGSASNPIRYGDHESTGVSPGDLLSTIQLSRFGP
RYGSERLNGRSVFYDAASGMKTPAGGPPSPLATPGQPLFRFPAQNVTFQRQDSLDQDAIF
RESILDCMMKALGLTGSTQDALRKTHNSGDASPHLVSYDSRRQKAVFNNAFGFIDPYDGF
GDGDSESLMSMSVTSAGGTSPVHNLRTELQDEIEIVYFPKGSVLIEQGEHNPGLYYVIDG
FLDVGIPVNEKGEDLIGSSRRPTAEDILLPITGNASRVSSTLGTAHNQRKKASRRSLYMV
KPGGVEGYIGSITSYRSFTDVTAKTDVYVGFLPRAVLERIADRYPLVMLTMAKRLTTVLP
RLILHIDFALEWVQVNAGQVIHHQGDESDAIYIVLNGRLRAVLDKGDGKVSVLGEYGQGD
SVGELEVMTESTRPGTLHAIRDTELAKFPRTLFNSLAQEHPGITIQISKLIAQRMRHIID
NPLEKGSDKGSPDSAKPTTSTLNLRTVAVLPVTAGIPVVEFGNRLLNAFNQVGVTNGVTS
LHQADILNHLGRHAFSKMGKLKLAQYLADLEERYGMVLYVGDTSVNAPWTQTCIAQADCI
LLVALAEGSPAIGEYERFLLGMKTTARKELVLLHAERYSQPGLTRQWLKNRMWINGGHHH
IQMAFRLTAEPVHPETKRLGAVLKQRVQVIQAEIQKYTSRRIRQTPVYSTSTPVKGDFHR
LARRLCGKSVGLVLGGGGARGIAHIGVIKALEEAGIPIDIIGGTSIGSFIGALYARDADV
VPAYGRAKKFSGRMASMWRFALDLTYPSASYTTGHEFNRGIFKAFGNSHIEDFWLEFYCN
TTNISKSRLEFHSSGYAWRYVRASMSLAGLIPPLCDEGNMLLDGGYVDNLTVARMKSLGA
DVIFAVDVGAIDDNTPQGYGDSLSGFWALVNRWNPFSSLPNPPTLSEIQARLAYVSSVDA
LERAKSTPGCLYMRPPIDAFGTLDFAKFDEIYQVGYKFGKEFLDRLKNEGGLPIQEETEE
KKKLRRTMAPRRASI
NT seq 4728 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgacgaccaccatgcctgcggctgtggcgcccgaccctccagcgcagctcgcc
gtctcgtcacggagcttgagcgacagcagtgacgcagctggtgcctccagaacgtcgtcg
tcctgccgggcctcgtcgccctcgcactgcccgacccatgcctggaatccggacccaccg
ccctcctccctccagcccgtcttttctttttctccctccctgccgccgccctgcccctcc
cccgcgatctcctcctgtcctcccaacaccctctctcctccaaatctcctccagggcatt
gtgtcccagctcgccatggcgtcctacatcgggcgtctgctcctctacctcttccaggtc
gtgcccagcctgctctactgggccatcaccttcactacaatcaccgtcccgacagcgctg
ttcaccctcttttccatgagcttgacctttaccatgaactttacgacacttctcataata
gtattgctacttgtatctaccgttagctggttcatccgttatcgatttcttaatatctac
tcccggttaccgccagagccgcagaggaaagagcccgagatagacctctttcccgactcg
caggatggcgactcaaaacctggcttgtccaattaccttgacgagtttctcagcgccata
aaagtgtttggctacctggagcggcccgtctttcatgagcttacacgaacaatgcaaaca
cgaaagttgattgccggtgaaacgctgctgttggaagaggagaaaggcttttgcttggtc
gtcgatggattggtccagatattcgtcaagtcgatccaagagcgggacgatgatcgggat
ggctggcagctggatgaagccgttgaggattcggtcgatgaagatgatgagattcggcgt
cggggtcatcagggataccaattgctcactgaggtgaaaaacggtgcgtcgatgtcgtct
ctcttctcgattctatccctattcagcgaagatatcaaattacgtcataacgaagatatg
gagtcaagctcctcaagctttaacaatgtccccgcacccgattcaaacccaatgagcccg
gctcttcttttagagagtcccacgagggtgagctttcccgatcagcgagatatcccaacg
cagccaagcgcagacactctgcccaaggtctcccctctagctttggagggaagccccggt
ccattcgagcacgatccaaagccccgcggccatcgacgcaagaggccctcaaggcctaaa
cgggccaagtccgttcatcccgacattttggcgcgagctatggtggatactaccattgca
attattcctgcgagtgctttccgacgcttgaccagggtgtacccgaaggctaccgcccat
atcatacaggttattctcacgagacttcagcgcgttacctttgctactgcgcattcatat
ctcggattaaccaccgaagttttgagcattgagcagcaaatgaccaaatatacatccttc
gacctacctaaccaccttcgtggagcagcgctggataagctaaagtctaaatttacaaaa
gaaaaggaaagattaggccccgaggacgggacaaaaggcattgcgcttcacaacccggct
ctcaaccggagaagaaggtctagtagttcactgagaaaagatgctgcattacatgctaag
cttacagcggtgcgaggaaaagggtcagcttcgaatcctattcgatatggtgatcatgaa
tccaccggtgttagccctggagacttattatctaccatacaactctcgcgctttggccct
cgatacggaagcgagcggttgaacgggaggagcgtcttttacgatgcagcttctggcatg
aaaactcctgctggagggccaccaagtccactagcgacccctggacaaccgctgtttaga
tttccggctcaaaatgttaccttccaaagacaagattctttggatcaggacgctattttc
cgtgaatccattcttgattgcatgatgaaggcactggggctcacgggaagcacccaagac
gccttgcgcaaaacgcataattccggggatgcttcccctcacctagtctcctacgactca
cgccgtcagaaagccgttttcaataacgcctttggtttcatagacccatatgacggcttc
ggcgatggagattctgaatcgctcatgtcaatgtccgttacatctgcagggggcacgtcc
ccggttcataaccttagaactgaactacaagatgaaatcgagatagtctactttcccaag
ggctccgtgctcatagaacagggggagcataatccaggcttatactatgtcattgatggc
tttctagacgtcggtattcctgtcaatgaaaagggagaagatcttataggttcttctcgg
agacctacagccgaggacattctactaccaattacaggtaacgcctcaagggtgtcatca
acgcttggtaccgcacataaccagaggaagaaggcctcccggcgttccttgtatatggtt
aagcctggcggtgttgaaggatacattggttctataacgtcatatcgatcgtttacggat
gttaccgcaaaaacggatgtctatgttgggtttcttccacgagcggtgctggagagaatc
gctgatcgatatcctttggtcatgctcacgatggcaaaacggttgacgacggtcctacca
cgacttattttacatattgacttcgctctcgaatgggtccaagtcaatgctggacaagtt
atacaccatcaaggggacgagagtgacgcaatttacatcgtcttgaacggtcgactccgt
gccgtccttgataaaggagatggaaaagttagcgtcctgggcgaatacggccagggcgac
agcgtcggagagttagaagtcatgactgaatcgacacggcccggtaccttgcatgcaatc
cgtgacacagagctagcgaaattccctcggaccttgtttaatagccttgctcaggagcat
cctggcataacaatccaaatttcaaagttgatagcccaacggatgcgtcacataatagac
aacccacttgaaaagggcagtgacaaaggcagcccagacagcgccaagccgaccacgtct
actttgaatttacgaaccgtggccgttctgcctgttaccgccggtattcctgtggttgag
ttcgggaacagactgttgaatgcctttaatcaggtcggcgtgacgaatggtgtcacttcc
ctccaccaagccgatattttaaaccatcttggccgacatgcgttcagcaagatgggtaag
cttaaactcgcgcagtatctcgcagatctcgaggagagatacggaatggttctgtatgtt
ggagatacaagcgtcaatgcaccctggacccaaacatgtattgcccaggcggattgcatt
cttcttgtcgccctagccgaaggttctcctgcgattggtgaatatgagcgcttccttctt
gggatgaagacgaccgcaagaaaagagcttgttcttttgcacgctgagagatactcccaa
cctggtctcaccagacaatggttaaagaatcggatgtggattaacggaggtcatcatcat
atccaaatggcgttccgtctgacagcggaacccgtccatccagagactaaacgcctcggc
gccgtgctcaagcagagagttcaagtcatccaggctgagattcaaaagtacacctctcgc
aggattcgccagacgccagtttattccacatcgaccccggtcaaaggtgatttccaccgg
ctcgctcgtcgtctatgcggcaagtctgtcgggctagtgctgggtggcggaggtgcaaga
ggtattgcccatattggcgtgataaaggcactggaagaggctggaatccctatcgatatc
attggaggcacatccattggatcctttattggcgcattatatgctcgagacgcggacgtt
gtccccgcatacggccgcgcgaagaagttttcaggacgcatggccagtatgtggcgtttc
gctttggatctcacttacccctcggcttcatataccaccggtcacgaatttaatcgcgga
atatttaaggcgtttgggaatagccacattgaagatttctggctagaattctattgtaat
acgactaatatcagcaagtcacgacttgagttccactcgtctggctacgcgtggcggtat
gttcgtgcttctatgtctctagcaggcttgatacctcctctctgtgatgaaggtaacatg
ctacttgacggtggatacgtggacaatctcacggttgcacgcatgaaatctctcggcgca
gatgtcatcttcgccgttgacgttggtgcgatcgacgacaacactccacagggatatggt
gattccctttccggcttttgggcgttagtcaacaggtggaacccgttttcctccctccct
aacccgccaacactctccgagatccaagctcgactcgcatacgtttcgtccgtggatgct
ttagaacgggccaagtctacgccgggatgcctttacatgaggcccccgatcgacgccttt
gggactctggattttgcaaaattcgacgagatttaccaggttgggtacaagtttggcaaa
gagttcttggaccggttgaagaacgaaggtggattgccgattcaggaggagacggaagag
aagaagaagctaagacggacgatggcaccgcgccgggcgagtatttga

DBGET integrated database retrieval system