KEGG   Coccidioides immitis: CIMG_08896Help
Entry
CIMG_08896        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
cim  Coccidioides immitis
Brite
Exosome [BR:cim04147]
 Exosomal proteins
  Proteins found in most exosomes
   CIMG_08896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 132 aa AA seqDB search
MTSTAYVDTSLVGSGHIDKAAIFDNQGTSVWATSAGFSVSPAEVKVIVDSFNPVSGDAIK
EVQSGGFFVGGDKYVALRSDESRLYGKKGKEGVVIVKTKKALLIAHYPETVQPGAATNTV
ETLGDYLIGLGY
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccacagcttatgttgatacaagtctcgtcggctctggccacatcgataaggcc
gccatcttcgacaaccaaggcaccagcgtttgggcaacgtctgccggattctcggtctct
ccggcagaggtgaaagtcatcgtcgactcctttaatcccgtatctggcgatgcgatcaag
gaagtgcagtccggcggattcttcgtcggtggagacaaatacgttgctctacgatcagac
gagtctcgcctctatggcaagaagggcaaagaaggcgtcgtgatcgtgaagacgaaaaaa
gctctcctcatcgcacattacccggaaaccgtccaacccggcgccgcgactaacacggtg
gaaactctcggcgactacctcatcggattaggttattag

DBGET integrated database retrieval system