KEGG   Coccidioides immitis: CIMG_09252Help
Entry
CIMG_09252        CDS       T01114                                 

Definition
similar to protein disulfide isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cim  Coccidioides immitis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cim00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CIMG_09252
Enzymes [BR:cim01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CIMG_09252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 370 aa AA seqDB search
MARLSSLLVASLALLTNVVNADSAVLDLIPSNFEKIVLESGKPGLVEFFAPWCGHCRNLA
PVYEQLGHAFAHASDKLHISKVDADAHKSLGKKNKVQGFPTLKWFDGKSAEGEEYEGGRD
LESLAKFVTDKTGVKPKGIKKAGDSVVKMLTDQSFAKEVGGDKHVFVAFTAPWCGHCKTL
APTWEALTEDFMREPDVLIAKVDAEAEQSKATARDQKVTGYPTIKFFPKGSKEGETYSGP
RSEDALVNFVNEKCGTHRAVGGGLNAKGGAIEALDDIVARYVSGGAIAEIAKDIKAAAGD
LKQKYAQYYVKVATKLSENSGYAAKELARLEKMKSKGSLAPEKLDDLVSRSNILRRFLGK
EGKKGAKDEL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggctcgattgagcagcctcctcgtggcctccctggctctcctcaccaatgtcgtcaat
gccgactccgccgtcctcgatctaatcccctccaactttgaaaaaatcgtccttgaatcc
ggcaagccgggactcgtcgagttcttcgccccctggtgcgggcactgccgcaaccttgct
ccggtctacgaacagctcggccacgccttcgcccatgcaagtgataaactgcatatcagc
aaggtcgatgcggatgcgcataagtctctaggcaagaagaataaggtccagggcttccca
acgctgaaatggttcgatgggaagagcgctgagggtgaagagtatgagggtggaagggat
ctggagagcctagccaagtttgttacggataagaccggcgtgaagcccaaggggataaaa
aaggctggggacagcgtggtgaagatgttgacggatcagtcgtttgcgaaggaagttgga
ggagataagcatgtttttgtggcctttacggctccatggtgcggtcactgcaaaaccctg
gctcctacatgggaagctctcactgaggatttcatgcgtgaacctgacgtccttatcgcg
aaagtcgacgctgaagcagaacagtcgaaagccactgcccgcgaccaaaaggtcactggc
tacccaacaattaaattcttccccaagggttctaaagaaggcgagacctacagtggtccc
cggtctgaagacgctctggttaatttcgtgaacgagaaatgcggaacacaccgtgccgta
ggaggaggattgaatgccaaaggcggggccattgaagctctcgatgatattgtagccaga
tacgtttccggaggagcaattgctgagattgcaaaggacatcaaggctgccgcaggagat
ctcaagcagaaatatgcgcagtattatgtcaaggtggccaccaagctttccgagaattct
ggatatgctgctaaagagctggcgagattggagaagatgaagagcaagggtagcctggct
ccagagaaattagacgatctggtctcaagatccaatatcttgagaagatttttgggcaag
gaaggaaagaaaggagccaaagatgagctttga

DBGET integrated database retrieval system