KEGG   Coccidioides immitis: CIMG_09361Help
Entry
CIMG_09361        CDS       T01114                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cim  Coccidioides immitis
Pathway
cim00010  Glycolysis / Gluconeogenesis
cim00051  Fructose and mannose metabolism
cim00562  Inositol phosphate metabolism
cim01100  Metabolic pathways
cim01110  Biosynthesis of secondary metabolites
cim01130  Biosynthesis of antibiotics
cim01200  Carbon metabolism
cim01230  Biosynthesis of amino acids
Module
cim_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cim_M00002  Glycolysis, core module involving three-carbon compounds
cim_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CIMG_09361
   00051 Fructose and mannose metabolism
    CIMG_09361
   00562 Inositol phosphate metabolism
    CIMG_09361
Enzymes [BR:cim01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CIMG_09361
Exosome [BR:cim04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CIMG_09361
  Exosomal proteins of bladder cancer cells
   CIMG_09361
  Exosomal proteins of melanoma cells
   CIMG_09361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-GeneID: 4558738
NCBI-ProteinID: XP_001239740
UniProt: J3K265
AA seq 249 aa AA seqDB search
MARKFFVGGNFKMNGTQKSITDIITNLNSANLDPNTEVVISPPSLYLILSRSLADPKIGV
ASQNVFDKPMGAYTGELSVEQLQDCGISWTLVGHSERRVILKEDDDFAARKTKSAIDGGL
SVILCVGETLEEREADKTVDVVTRQLGAVASRLSAQDWSKLVVAYEPVWAIGTGKVATTE
QAQEVHAAVRKYIAESVSPSVAENLRIIYGGSVNEKNCKELAKQADVDGFLVGGASLKPA
FVDIVNARL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcaaattcttcgttggcggtaacttcaagatgaatgggactcaaaagtccatc
accgatatcatcaccaatcttaacagcgccaatctcgatcccaacaccgaagtcgtcatc
tcccccccttccctctacctcatcctctcccgtagccttgccgatcccaagatcggcgtt
gcctctcagaatgtcttcgataagcccatgggagcgtacactggtgagttgagcgtggaa
caattgcaggactgcggtatttcctggacattggttggacacagtgagcggagagttatc
ttgaaggaggatgacgactttgctgcacgcaagaccaagtctgctattgatggcggattg
agcgttattctctgcgtcggagagactcttgaggagcgtgaggccgacaagactgtcgat
gttgtgaccagacaactaggcgcagttgcttccagactcagcgcccaggactggtctaaa
ttggttgttgcatacgagcccgtctgggccattggaaccggcaaggttgccacaaccgag
caggcccaagaggtccatgctgcagtccgcaagtacatcgcggagagcgtttcgcccagt
gttgctgagaacctccgtatcatctatggcggcagtgtcaatgagaagaattgcaaggaa
cttgctaaacaagcggatgttgatggattcctggtcggtggagctagtttgaagccagca
ttcgttgacattgtcaatgctcgtctctaa

DBGET integrated database retrieval system