KEGG   Coccidioides immitis: CIMG_09385Help
Entry
CIMG_09385        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
cim  Coccidioides immitis
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cim00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 440 aa AA seqDB search
MALAASDPPGLYKGRSPRSFSETNVAPHSKRRRARSVFRCWGNFCLKHTWVIPLVLLTVI
LSAYAVNPNDSNPIHQLIFLSYPLPPETPDGPVMYGKGPADMAFVVFYTIVLSFTREFLM
QRMIKPLARRCGIKGKAKTSRFMEQFYTAVYFAIFGPYGLYVMSRTKIWYFNTTAMFEGF
PHKTHTADFKAYYLLEASYWAQQAIVLVLQLEKPRKDFKELVGHHIVTLALIALSYRFHF
TYIGLAVYITHDVSDFFLATSKTLNYLDSAIMGPYFAMFIAIWIYMRHYLNLRIIWAVLT
EFRTVGPFELNWETQQYKCWISQYITFALLSALQAINLFWLFLILRIAKRYLLNNIRQDE
RSDNEEEEEEVEDTPHSDKTNNGSTTVPTILLNGNSPTSVRRRNADKENEVSNGVTNGRA
TGSTAHSHAESSTPTMNGKK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggctctcgccgcttcggatccccctgggttgtacaagggccgatctccgcgatcattt
tctgaaacaaatgtcgctccccactcgaagcggcgtcgtgcgcgctcggtgtttcgctgc
tgggggaacttctgcctcaagcacacatgggtcatacctctcgtcctgttaacagttatc
ctctccgcctacgctgtgaatccaaatgattccaatcccatacaccagctcatcttcctc
tcctatccacttcctcctgaaacacccgatggaccggtgatgtatgggaagggccctgcc
gacatggcctttgtggtgttttacacaatcgtgctctccttcacacgtgaatttttgatg
cagaggatgatcaaaccgctggcgcgtcgctgtggaataaaggggaaggcgaaaacttcc
cgtttcatggaacagttctacaccgctgtttactttgccatcttcgggccctacggtcta
tatgtcatgagtcgcacgaagatatggtacttcaatacgacggcgatgttcgaaggcttc
ccccacaagacgcacactgccgatttcaaggcgtattacttgcttgaggcaagctactgg
gcccagcaggccatcgttttggttttgcagctggagaaacctaggaaggatttcaaagag
cttgtgggacatcacatcgtcacactggcgttgattgcgctcagctatcgtttccatttc
acttatatcggcctggctgtctatattacacatgatgtgtcggacttcttccttgcgact
tccaaaacactaaattatttggattctgcaatcatgggcccttactttgcgatgtttatt
gccatctggatttacatgagacattacctgaatctccgcattatctgggctgtcttaacg
gaatttcgaactgtcgggcccttcgagctcaattgggaaacacagcaatacaaatgctgg
atcagtcagtatattacatttgcacttttgagcgcgctgcaggccataaacttgttctgg
ctcttcctgattcttcgaatcgcaaagcgatatcttctcaacaacatcagacaggatgaa
cggagcgataatgaagaggaagaggaggaagtcgaggatacacctcacagcgacaaaact
aataatggttcaacaaccgtcccgacgatattacttaacggaaacagcccgacatcagtt
aggagaagaaatgctgataaggagaatgaagtttctaacggtgttaccaatggccgtgcg
actggctctacggcacattcacatgctgaatcctcgacacccaccatgaatggcaagaag
taa

DBGET integrated database retrieval system