KEGG   Coccidioides immitis: CIMG_09572Help
Entry
CIMG_09572        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
cim  Coccidioides immitis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cim00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CIMG_09572
Exosome [BR:cim04147]
 Exosomal proteins
  Proteins found in most exosomes
   CIMG_09572
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1680 aa AA seqDB search
MAPLPIKFTELLQLTNLDIVPASIGFNSCTLESDSFVCVRQKLPESDKTQVIIINLKNNN
EVVRRPINADNAIMHWNRNIIALKAQGRTVQVFDLQAKEKLKSAVLTEDVVYWKWFSETS
LGLVTEAAVYHWNVFDPSQHAPIKMFDRIANLNGCQIISYKVNEDQKWMAVVGISQQQGR
IVGTMQLHSVERGISQHIEGHAAAFASISVEGSPLPHKLFTFAVRTQTGAKLQIAEIDHQ
EPNPKFAKKAVEIYFPPEATNDFPVAMQVSKKYDIVYLVTKFGFIHLYDLETGTCIFMNR
ISSETIFVTTPDSESTGLVGVNRKGQVLSVSVDESTIIPYLLDNPANTSLAVKLAAKGGL
PGADNLLQRQFETLLSQQNYIEAAKVAANSPRGFLRTPETINRLKSAPQSAQGMSVILQY
FGMLLDKGSLNKYESIELVRPVMQQSRKHLLEKWLSEDKLECSEELGDIVRPYDVGLALG
IYLKANVPHKVVAGFAETGQFDKIIAYSKQVGFQPDYVQLLQHIVRVNPEKCAEFAGQLV
SEESGAVVDLDRVVDVFISQNMIQQATAFLLDALKDNKPEHGHLQTRLLEMNLVNAPQVA
DAILGNEMFTHYDKARVSQLCEGAGLYQRALENTEDPAVIMRNIVRTDKLNPDWLSNYFG
RLSVEQSLECMNEMLKVNLRQNLQAVVQLATKYSDLLGATNLINLLEKYRTAEGLYYYLG
SIVNLSEDPDVHFKYIEAATKMGQMTEVERICRESNYYNAEKVKNFLKEARLTEQLPLII
VCDRFNFIHDLVLYLYQNQQYNSIEVYVQRVNPSRTPAVVGGLLDVDCDEGIIKNLLSTV
DPSSIPIDELVSEVETRNRLKILLPFLESTLATGNQQQAVYNALAKIYIDSNNNPEKFLK
ENDLYDTLVVGKYCEKRDPNLAYVAYRKGQNDLELINITNENSMYRAQARYLLERADPEI
WAFVLNSNNIHRRSLVDQVIATAVPESAEPDKVSIAVKAFLDADLPTELIELLEKIILEP
SPFSDNSSLQNLLMLTAAKADKGRLMDYIHQLTEFNADEIASMCLSVGLYEEAFEIYKKV
DNHISATNVLVDYIVSIDRAQEYAERVELPEVWSKVAKAQLDGLRVSDAIASYIRAGDPS
NYNEVIETATHAGKDEDLVEFLKMARKTLREPAVDTALALSYARLNQLPELEDFLRGANV
ADIEASGDKAYEEGYHEAAKIFFTSISNWAKLATTLVHLEDYQAAVECARKGNSVKVWKQ
VNEACVAKKEFRLAQICGLNLIVHAEELQDLVRQYERNGYFDELIALLEAGLGLERAHMG
MFTELGIALSRYHPDRVMEHLKLFWTRINIPKMIRACEEANLWPELVFLYCHYDEWDNAA
LAMMERAADAWEHHSFKDIIVKVANLEIYYRALNFYLQEQPLLLTDLLQVLTPRIDVNRV
VRMFEKSDNIPLIKPFLLNVQPQNKKAVNNAINDLLIEEEDYKTLRDSVENHDNYDPVEL
AQRLEKHDLVFFRQIAASIYRKNKRWEKSISLSKQDKLFKDAIETAAISGKTEVVEDLLR
YFVDIGSRECYVGMLYACYDLIRPDVVLEMSWRHGLNDFTMPYMINMLSQQVRTIEMLKK
DNEERKAKEAAQQKEEDNTPVLGGTRLMLTQGPASPAAHAMPLGGQTNGITPQMTGFRPF
NT seq 5043 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctcttccgattaaatttacggaactacttcagttgacgaacctcgatattgtg
cccgcatctatcggattcaattcatgtacccttgaatccgattcattcgtgtgcgttcgt
caaaagttacccgaaagtgacaaaacgcaagtcattatcatcaacctcaagaataataat
gaagtcgttcgtcggcccatcaacgccgataatgctatcatgcattggaaccgaaacatc
atcgccctcaaggcccagggtagaaccgttcaagtctttgacctccaggcgaaggagaaa
ttgaaatccgccgtgctcaccgaggatgttgtgtattggaaatggttcagcgagacgagt
ttgggcctggtaacagaggctgcggtttaccattggaacgtcttcgatccgtctcagcat
gcgcctataaagatgtttgaccgcatcgctaatctaaacggatgccaaatcatcagctac
aaagtcaacgaagatcagaaatggatggctgtcgtcggtatcagccagcagcaaggacgc
attgttggaacgatgcagcttcactccgtcgagcgtggtatttcacagcacattgaaggc
catgccgccgctttcgcatccatctctgtcgaaggctcccccttgccgcacaagcttttc
acgtttgctgttcgcactcaaaccggagcaaaactgcagatcgcggagatcgatcaccaa
gaacctaatccgaagtttgcgaagaaggctgtggagatctacttcccaccagaggcgacc
aatgatttcccggtcgcgatgcaggtttcgaagaaatatgacattgtatatctcgtcaca
aaattcggcttcattcatctatatgacctagaaaccggcacgtgcattttcatgaaccgc
atctcaagcgagacgatcttcgttacgactccagactcggaatccacgggtctggtcggg
gtcaaccgcaagggtcaagtcctatccgtcagcgttgacgagagcaccatcattccttac
ctcctcgataatccagccaacacatcgcttgctgttaagctggctgctaagggaggcctt
ccaggtgcagataatcttctccagagacaattcgagacgctcctttcccagcagaactat
atagaggctgcaaaggttgcggcaaactcaccacgtggcttcctccgtaccccggagacc
attaaccgcctcaagagcgctcctcagagtgcacaaggaatgtccgtcattctccagtat
ttcggcatgctgttggacaagggttcgttaaacaagtatgaaagtattgaattggttcga
cccgttatgcagcagagtcgaaagcatctgctcgaaaaatggcttagtgaggacaagctt
gagtgttctgaggagctgggtgatattgtgcgaccatacgatgttggccttgctttgggg
atctatttgaaggcaaacgtcccccacaaagttgtcgctgggtttgcggaaaccggacag
tttgacaagattattgcttactccaagcaagttggcttccagcctgattatgtccaactt
ctccagcacatcgttcgcgttaaccccgaaaagtgtgccgagttcgctggtcaacttgtt
agcgaggagagtggcgccgtcgtcgatctcgatcgtgtggttgatgttttcatatctcaa
aatatgatccaacaagccactgctttcttgctggatgccctcaaggacaacaagccggaa
catgggcacctccagactcgcctcctggaaatgaatctcgtaaatgctcctcaggttgcg
gatgctattctcggaaatgaaatgttcacccattacgacaaggccagggtctcacaactc
tgcgaaggtgctgggttgtaccagcgagctttggagaacaccgaggatcctgcggtcatc
atgcgcaatatcgtccggaccgataaattaaatcccgactggctgtccaattacttcggg
cgcttgtcagttgaacagtccttggagtgtatgaacgaaatgctcaaagtgaacctgcgg
cagaatcttcaagccgtggtgcagttggctaccaagtactcggacctgttgggcgcgacc
aacttgatcaatctcctcgagaaataccgaacggcagaaggcctatactactaccttggc
agcatcgtcaatttgagcgaagatcctgacgtgcacttcaagtatatcgaagccgctacc
aagatgggccagatgacagaggttgagcgaatctgccgtgagagcaactactataatgct
gagaaagtcaagaacttcctcaaggaggcccgtctcaccgagcagcttcctctaattatt
gtctgtgacagattcaatttcatccacgatttagtcctttacctgtaccagaatcagcag
tacaattccattgaggtatatgttcagagagtcaatccgtctcgaacaccagctgttgtg
ggaggacttctcgacgtcgattgcgatgagggcattatcaagaatctcctttcaaccgtg
gatccttcgtccattccgatcgatgagcttgtctccgaggtagagacccggaaccgcttg
aagattctccttccattccttgagagcactcttgctaccggaaaccagcaacaggcagta
tataacgcccttgccaagatttacattgatagcaacaataatcccgagaagttcttgaag
gagaatgatctctacgatacattggttgtcggtaaatattgcgagaagcgtgatccaaac
ttggcttacgttgcgtaccgaaagggccaaaatgacttggagctcatcaacatcaccaat
gagaattcgatgtaccgagcccaggcaagatatcttcttgaacgcgccgacccggagatt
tgggcctttgtattaaacagcaataacatccaccgccgctctctggtcgatcaagtgatt
gccaccgccgtgccagaatcagccgagccagacaaggtttccattgccgttaaagctttc
ctcgatgctgatttgcctacagagctgatcgagctcttggagaagattatcctggagcca
tctccattcagcgacaacagcagtctgcagaatctcttgatgcttacggctgccaaggcg
gacaagggccggttgatggattacatccaccagctgacagagttcaatgccgatgaaatc
gcaagcatgtgtctgtctgtcggcctgtatgaagaagcgttcgagatctacaagaaggtt
gacaaccacatctccgccacaaacgtgcttgtcgactatattgtcagcattgaccgcgcg
caagagtacgctgaacgtgttgagctcccagaagtctggagcaaagtagcaaaggctcag
ctggatggccttcgcgtttccgatgccattgcttcgtatatccgggctggagacccatcg
aactacaatgaagtcattgagaccgccactcacgccggcaaggacgaggacctcgtcgaa
ttcttgaagatggcccgaaagactctccgtgagccggctgtcgacactgcgctcgccctc
tcctatgccagacttaaccagcttcctgagcttgaagacttccttcgcggagctaacgtt
gcagacatcgaagcttctggcgacaaggcctacgaagaagggtatcacgaagccgccaag
atcttcttcactagtatctccaactgggcaaaactcgccaccaccctcgtccatctcgag
gattaccaggctgcggtcgaatgcgctcgaaaaggaaacagcgtcaaggtctggaagcag
gttaacgaggcctgtgttgccaagaaagagttccggctggcccagatctgcggtctcaac
ctcatcgtccacgcggaggagttgcaggacctggtgcgccagtatgagcgtaacggatac
ttcgacgagctcatcgctttgctcgaggccggtctaggcttagagagggcacacatgggc
atgttcaccgagctcggcatcgccctgtcgagatatcacccggacagagtgatggagcac
ctgaagcttttctggacacgcatcaatatccccaagatgatccgagcctgcgaggaagcg
aatctctggcccgagctggtattcttgtactgccattacgacgagtgggataacgctgcc
ttggcgatgatggagcgggcggcggatgcctgggaacaccactccttcaaggacatcatt
gtgaaggtggcgaacctggagatctactaccgggcactaaacttctacctccaggaacag
ccgctgctgctgacggacctgctgcaagttcttacgccacggatcgatgtgaatcgggtg
gtgcgcatgttcgagaagtccgacaacatcccgctgatcaagccgttcctgctcaacgtc
cagccccagaacaagaaagcggtcaacaacgcgatcaacgatctgctgatcgaggaagag
gactacaagacgctgcgcgactccgttgagaaccacgacaactacgacccggttgagctg
gcgcagaggctcgagaagcacgacctggtgttcttccgacagatcgcggcgagcatctac
cgcaagaacaagcggtgggagaagtcgatctcgctgtcgaagcaggacaagctcttcaag
gatgcgatcgagacagcggcaatttcgggcaagaccgaggttgtggaggaccttttacgt
tactttgtggacatcggcagccgcgagtgctatgtgggcatgctgtacgcgtgctacgat
ctgatccggccggacgtggtgcttgagatgtcgtggcgacacgggctgaacgacttcacg
atgccgtacatgatcaacatgctgagccagcaggtgcggacgatcgagatgctgaagaag
gacaacgaggagcgcaaggcgaaggaggcggcgcagcagaaggaggaggacaacacgccg
gtgcttggggggacgagactgatgctgacgcagggaccggccagcccagcagcgcacgcg
atgccgcttggagggcagacaaatgggatcacgcctcagatgacgggcttccggccattc
taa

DBGET integrated database retrieval system