KEGG   Coccidioides immitis: CIMG_09619Help
Entry
CIMG_09619        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cim  Coccidioides immitis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cim00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cim00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 176 aa AA seqDB search
MSSATSFFDFATPDKKGEPFPLSSLQGKVILVVNTASKCGFTPQLQGLEALYKKISADYP
DKFTVLGFPCNQFGSQDPGTNDEIQSFCQVNYGVTFPILGKVDVNGDKAAPVFEWMKKEM
PGLMGLKRVKWNFEKFLISADGKVVGRWASITKPESLEAPILKEIEKMEKGGRTSL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcagcaaccagcttcttcgactttgcgacccccgacaagaagggcgaacctttc
cccctctcctccctccaaggcaaggtaatccttgtcgtcaataccgcctccaaatgcggt
ttcaccccgcaactccaaggcctagaggctctctacaagaagatctccgccgactatcca
gacaaattcactgttctcggtttcccctgcaaccaattcggttctcaggaccctggcacc
aacgatgaaatccagtccttctgccaggtcaattacggcgtgacgttccccattctcggc
aaagtcgatgtcaacggcgataaagcggcaccggtatttgagtggatgaagaaggaaatg
cctggccttatgggcctgaagagggtcaagtggaactttgaaaagttcttgatcagtgca
gacgggaaggtcgttggaaggtgggcgagtattacaaagccagagtccttggaggcgcca
atcttaaaggagatcgaaaagatggagaaaggaggaaggacttcgctgtag

DBGET integrated database retrieval system