KEGG   Coccidioides immitis: CIMG_09619Help
Entry
CIMG_09619        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cim  Coccidioides immitis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CIMG_09619
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CIMG_09619
Enzymes [BR:cim01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CIMG_09619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 176 aa AA seqDB search
MSSATSFFDFATPDKKGEPFPLSSLQGKVILVVNTASKCGFTPQLQGLEALYKKISADYP
DKFTVLGFPCNQFGSQDPGTNDEIQSFCQVNYGVTFPILGKVDVNGDKAAPVFEWMKKEM
PGLMGLKRVKWNFEKFLISADGKVVGRWASITKPESLEAPILKEIEKMEKGGRTSL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcagcaaccagcttcttcgactttgcgacccccgacaagaagggcgaacctttc
cccctctcctccctccaaggcaaggtaatccttgtcgtcaataccgcctccaaatgcggt
ttcaccccgcaactccaaggcctagaggctctctacaagaagatctccgccgactatcca
gacaaattcactgttctcggtttcccctgcaaccaattcggttctcaggaccctggcacc
aacgatgaaatccagtccttctgccaggtcaattacggcgtgacgttccccattctcggc
aaagtcgatgtcaacggcgataaagcggcaccggtatttgagtggatgaagaaggaaatg
cctggccttatgggcctgaagagggtcaagtggaactttgaaaagttcttgatcagtgca
gacgggaaggtcgttggaaggtgggcgagtattacaaagccagagtccttggaggcgcca
atcttaaaggagatcgaaaagatggagaaaggaggaaggacttcgctgtag

DBGET integrated database retrieval system