KEGG   Coccidioides immitis: CIMG_09701Help
Entry
CIMG_09701        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
cim  Coccidioides immitis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cim00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cim00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:cim03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cim03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:cim03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:cim03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cim03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 211 aa AA seqDB search
MPPTRRRSGNPASTRHQQTLSFGTKSRISKPTSGPSSKHLKDISSPSPTAEPELAGRKGV
SKSPSPAAPTLVADVAEQEVVVPAQPIAASSKSENVVREQARVQLQAPKSAEDKKAEALT
EEDIRRYWEAEEAKMSAPRVHQEGLSIHEKILRHFDLSNQYGPCIGIARIKRWRRAHTLD
LNPPIEVLAVLVKDEARGVAREKAYIDELLS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccacccgccgccgctctggcaaccccgcctccaccagacaccaacaaaccctc
tctttcggcacaaaatcacgcatctcaaagcctacatctggcccatcctccaaacacctc
aaagacatctcctctccctcaccgaccgctgaacctgaactcgccggccgcaagggcgtc
tcgaagagcccatcgccagccgcacccaccctcgtcgcggacgtcgccgaacaggaagta
gtcgtacccgcacagcctatcgcagcatcatcaaaatccgagaatgtcgttcgcgagcaa
gcccgcgtgcaactccaagcgcccaagtcagccgaggataaaaaggcggaggcgttgacg
gaggaggatatacggcggtattgggaggcggaggaggcgaagatgagcgcgcccagagtg
caccaagaaggtctaagcatacacgagaagatcctccgacatttcgatttatcaaatcaa
tacgggccttgcatcggtattgcaagaataaaacgctggcgccgagcgcacacgttggat
ctgaatccacctatagaagtccttgccgtgctagtcaaggacgaagcgcgaggagttgcc
cgggagaaggcatatattgacgagttgttatcgtaa

DBGET integrated database retrieval system