KEGG   Coccidioides immitis: CIMG_09701Help
Entry
CIMG_09701        CDS       T01114                                 

Definition
(RefSeq) DNA polymerase delta subunit 4
  KO
K03505  DNA polymerase delta subunit 4
Organism
cim  Coccidioides immitis
Pathway
cim00230  Purine metabolism
cim00240  Pyrimidine metabolism
cim01100  Metabolic pathways
cim03030  DNA replication
cim03410  Base excision repair
cim03420  Nucleotide excision repair
cim03430  Mismatch repair
cim03440  Homologous recombination
Module
cim_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CIMG_09701
   00240 Pyrimidine metabolism
    CIMG_09701
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CIMG_09701
   03410 Base excision repair
    CIMG_09701
   03420 Nucleotide excision repair
    CIMG_09701
   03430 Mismatch repair
    CIMG_09701
   03440 Homologous recombination
    CIMG_09701
DNA replication proteins [BR:cim03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    CIMG_09701
DNA repair and recombination proteins [BR:cim03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      CIMG_09701
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     CIMG_09701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4 HrpE DUF3664
Motif
Other DBs
NCBI-GeneID: 4559177
NCBI-ProteinID: XP_001240080
UniProt: J3K2Y3
AA seq 211 aa AA seqDB search
MPPTRRRSGNPASTRHQQTLSFGTKSRISKPTSGPSSKHLKDISSPSPTAEPELAGRKGV
SKSPSPAAPTLVADVAEQEVVVPAQPIAASSKSENVVREQARVQLQAPKSAEDKKAEALT
EEDIRRYWEAEEAKMSAPRVHQEGLSIHEKILRHFDLSNQYGPCIGIARIKRWRRAHTLD
LNPPIEVLAVLVKDEARGVAREKAYIDELLS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccacccgccgccgctctggcaaccccgcctccaccagacaccaacaaaccctc
tctttcggcacaaaatcacgcatctcaaagcctacatctggcccatcctccaaacacctc
aaagacatctcctctccctcaccgaccgctgaacctgaactcgccggccgcaagggcgtc
tcgaagagcccatcgccagccgcacccaccctcgtcgcggacgtcgccgaacaggaagta
gtcgtacccgcacagcctatcgcagcatcatcaaaatccgagaatgtcgttcgcgagcaa
gcccgcgtgcaactccaagcgcccaagtcagccgaggataaaaaggcggaggcgttgacg
gaggaggatatacggcggtattgggaggcggaggaggcgaagatgagcgcgcccagagtg
caccaagaaggtctaagcatacacgagaagatcctccgacatttcgatttatcaaatcaa
tacgggccttgcatcggtattgcaagaataaaacgctggcgccgagcgcacacgttggat
ctgaatccacctatagaagtccttgccgtgctagtcaaggacgaagcgcgaggagttgcc
cgggagaaggcatatattgacgagttgttatcgtaa

DBGET integrated database retrieval system