KEGG   Coccidioides immitis: CIMG_09701Help
Entry
CIMG_09701        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
cim  Coccidioides immitis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CIMG_09701
   00240 Pyrimidine metabolism
    CIMG_09701
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CIMG_09701
   03410 Base excision repair
    CIMG_09701
   03420 Nucleotide excision repair
    CIMG_09701
   03430 Mismatch repair
    CIMG_09701
   03440 Homologous recombination
    CIMG_09701
DNA repair and recombination proteins [BR:cim03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      CIMG_09701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 211 aa AA seqDB search
MPPTRRRSGNPASTRHQQTLSFGTKSRISKPTSGPSSKHLKDISSPSPTAEPELAGRKGV
SKSPSPAAPTLVADVAEQEVVVPAQPIAASSKSENVVREQARVQLQAPKSAEDKKAEALT
EEDIRRYWEAEEAKMSAPRVHQEGLSIHEKILRHFDLSNQYGPCIGIARIKRWRRAHTLD
LNPPIEVLAVLVKDEARGVAREKAYIDELLS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccacccgccgccgctctggcaaccccgcctccaccagacaccaacaaaccctc
tctttcggcacaaaatcacgcatctcaaagcctacatctggcccatcctccaaacacctc
aaagacatctcctctccctcaccgaccgctgaacctgaactcgccggccgcaagggcgtc
tcgaagagcccatcgccagccgcacccaccctcgtcgcggacgtcgccgaacaggaagta
gtcgtacccgcacagcctatcgcagcatcatcaaaatccgagaatgtcgttcgcgagcaa
gcccgcgtgcaactccaagcgcccaagtcagccgaggataaaaaggcggaggcgttgacg
gaggaggatatacggcggtattgggaggcggaggaggcgaagatgagcgcgcccagagtg
caccaagaaggtctaagcatacacgagaagatcctccgacatttcgatttatcaaatcaa
tacgggccttgcatcggtattgcaagaataaaacgctggcgccgagcgcacacgttggat
ctgaatccacctatagaagtccttgccgtgctagtcaaggacgaagcgcgaggagttgcc
cgggagaaggcatatattgacgagttgttatcgtaa

DBGET integrated database retrieval system