KEGG   Coccidioides immitis: CIMG_09796Help
Entry
CIMG_09796        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
cim  Coccidioides immitis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CIMG_09796
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CIMG_09796
Enzymes [BR:cim01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CIMG_09796
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     CIMG_09796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2284 aa AA seqDB search
MPLFTSPSDAKPPQTPTSPQRTSRSDSLFPSAPSAGGAVAYVQNEQQPAQSAQSPIAPAV
IPPACAQITEDAGRSILLELEDGAIYHGLSFGAERSVAGELVFQTGMVGYPESITDPSYR
GQILVVTFPLVGNYGVPSRETMDELAKDIPKHFESSQIHIAGLVVASYCGEDYSHFLAES
SLGKWLKEQDVPAIYGVDTRALTKRIREEGSMLGRMMLQKSTSGKDLVNGVPTTADGEDS
EMWRENFEEIAWVDPNKRNLVDEVSIKEPRLYSPPKAGLLHPSGRPVRVLCVDVGMKYNQ
LRCLLARGVEVLVVPWNYDFHSLAKDYDGLFVSNGPGDPAMVSSTVANLAKALEECRTPI
FGICLGHQLLARAAGAGTTKMKFGNRGHNIPCTNLLSGRCYITSQNHGFAVDSSTLPEGW
EELFVNANDGSNEGIRHVSKPYFSVQFHPESTPGPRDTEFLFDVFINTVKKSIESPSGLN
EPVSFPGGTIEENRAAHPRVSVKKVLILGSGGLSIGQAGEFDYSGSQAIKALKQEGIYTI
LINPNIATIQTSKGLADKVYFLPVNADFVRKVIKHERPDAIYVTFGGQTALQVGIQLKDE
FEELGVKVLGTPIETIITTEDRELFARSMESIGEKCAKSASASTLEEAMEVVKGIGFPVI
VRAAYALGGLGSGFADNAEQLRDLCAKAFAASPQVLIEKSMKGWKEIEYEVVRDAQDNCI
TVCNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNP
FSKEYCIIEVNARLSRSSALASKATGYPLAFIAAKLGLGIPLNEISNSVTKVTCACFEPS
LDYVVVKIPRWDLKKFTRVSTQLGSSMKSVGEVMSIGRTFEEAIQKAIRAVDYTNLGFNA
TNALMSIKTELQTPSDQRLFAIANAMHSGYTVDDIWELTKIDKWFLRKLEGLSKFGKLIS
TFSASTVPVSLVRQAKQLGFSDRQLSKFLSSNELAIRRLRVEAGIMPVVKQIDTVAAEFP
AYTNYLYLTYNGSESDISFNDNGVMVLGSGVYRIGSSVEFDWCSVRAIRTLREQGHKTVM
VNYNPETVSTDYDEADRLYFENITLETVLDIYQLESSSGVIISMGGQTPNNIALPLHRLN
VNILGTSPEMIDAAENRYKFSRLLDRIGVDQPAWKELTSIEEATAFCDKVKYPVLVRPSY
VLSGAAMNTVYSQDDLANYLNQAAEVSRDHPVVITKYIENAKEIEMDAVAKNGVMVGHFI
SEHVENAGVHSGDATLILPPQDLDPETVRRIEEATRKIGNALNVTGPFNIQFIAKDNEIK
VIECNVRASRSFPFVSKVMNVDLIEMATKAMIGKPFVEYPPVNIPKNYVGIKVPQFSFSR
LSGADPVLGVEMASTGEVACFGRDRYEAYLKALISTGFKLPNKNILVSIGSYKEKMEMLP
SIRKLHQMGYNLFATAGTADFIREHGIPVKYLELLAGEEEDLKSEYSLTQHLANNLIDLY
INLPSSNKFRRPANYMSKGYRTRRMAVDYQTPLVTNVKNAKILIEAISRQFEMAVQPIDF
QTSHRTVVLPGLINVAAFVPGVANPDSSDFQSVTKASISAGFSMIRVMPVGVDSFLTDAR
ALKIAQHNSQKGTWCDYNLSVAATTSNADQIGQVAADVGSLYIPFNHLAGNINKVGTVTS
HFAAWPPTKPIITDAKATDLASVLLLASLHSRDIHVMSVTSKEDINLIALSKEKGLRVTC
DVAIYSLFLSTEDYPQCTHLPSKEDQEALWEHLSTIDIFCIGGLPYELAGKEAKPEVGIA
DALPLLLTAVWEGRLTLDDVTSRLYDNPKRIFELHDQPDASVEIEVDRPYVFQSEGVWSP
FNGKTLRGSVQRVTFQGKTSCLDGELVGDAARGTDMSAHRLAPPASPSIKEPPRSPRRDV
SVGRRLSFSTTPVARSSRLRPSDAAITSPGNELGPPLYTQLLSVPTASPSLMELLAQSSF
KQKHILSVNQFNRADLHLLFTVAQEMRLGVQRHGVLDILKGRVLSTLFYEPSTRTSASFD
AAMQRLGGRTVAVATEHSSTQKGESLQDTVRTLACYADAIVLRHPLESSAATAARFSPVP
IINGGNGSMEHPTQAFLDLFTIREELGTVSGITVTFIGDLRYGRTVHSLIKLLQFYEVRV
QLVAPKDLALPEDVRQHLVTSGQLVLETEELTPEVVARSDVLYCTRVQKERFEDLKEYER
LKNSFVVDNSVLKHAKSQMVVMHPLPRNAEIGEEVDFDQRASYFRQTRYGLYCRMALLAL
VMAP
NT seq 6855 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcttcacgtctccctcggacgcgaagcctcctcaaaccccgaccagtccccag
aggacctctagatccgactctctcttcccctctgccccctccgccggtggtgccgttgcc
tacgtgcagaatgagcagcagccagcccagtccgcccagtcgccaatcgcccccgcggtg
atcccccccgcctgcgcacagatcacagaggacgctggcaggtcaattctcctcgagctc
gaagatggagccatctaccacggcctcagcttcggcgccgagaggagcgtcgccggcgag
ctggtcttccagaccggcatggtgggctacccggagtccataacggatccctcctaccgc
ggtcagatcctcgtcgtcacgttccccctggtcggcaattacggtgttccgtcccgcgag
acgatggacgagctggcgaaggacatccccaagcacttcgagtccagccagatccatatc
gccggtctggtcgtggccagctactgtggagaggactactcccacttcttggccgagagc
tccttgggcaagtggctgaaggaacaggatgtgcctgcgatctacggtgttgacactcgt
gctctcacaaagagaatccgcgaggagggtagcatgcttggccgcatgatgctccaaaag
tctacaagcggcaaagacctagtcaatggcgtccccactaccgctgacggcgaggattct
gagatgtggcgggagaattttgaagaaatcgcctgggtagatcccaacaagagaaatctt
gtcgatgaggtctcaatcaaggagcctcgcctgtatagccctccaaaggctggcttactt
catccttcaggccggcctgtccgagttctctgtgtcgatgttggtatgaaatataaccaa
cttcgatgcctccttgcccgtggtgttgaggtcctcgtcgtgccttggaactatgatttc
cattcactcgcaaaggactacgatggtcttttcgtgtccaacggccctggtgatccggcc
atggtatcgtccaccgtcgcaaaccttgcaaaggccctggaagaatgccggacaccaatc
tttggtatctgtctcggccatcagctcctcgctcgagccgctggtgcaggcaccactaaa
atgaagtttggcaaccgtggtcataacattccttgcacaaacttgctgtcaggccgttgc
tatattacctctcaaaatcatggtttcgccgtggactcatcgacgcttcccgaaggatgg
gaagagttgtttgtcaatgccaatgacggaagcaatgaaggtatcagacacgtctctaag
ccttacttcagtgttcagttccacccggagagcacgcctggccctcgggataccgagttc
cttttcgatgtcttcattaatactgtgaagaagagtatcgagtctccttctggcttgaac
gagccggtcagcttccctggtggcaccattgaagagaaccgggccgcccaccccagagtc
tcggttaagaaggttctcattctcggcagtggcggcttgagtattggtcaagccggagaa
ttcgactactctggcagtcaggccatcaaggctctcaaacaagaaggaatttacaccatc
ctgatcaatccgaacatcgcgaccatccaaacttccaagggtctcgccgataaagtctac
ttcttacccgtcaatgctgatttcgtacgaaaggtcatcaagcatgagcgtcctgatgct
atttacgtcacctttggtggacagaccgcccttcaggtcggtatacagctcaaagacgag
tttgaagagctcggcgtcaaggttctcggtaccccaattgagaccattattaccaccgaa
gatcgtgagttgttcgctagaagcatggagtctatcggagagaagtgcgccaagtctgca
tctgcatctaccctcgaagaggctatggaggttgtcaaaggcattggcttccccgtcatc
gtccgtgccgcgtacgctctcggtggtcttggaagtggctttgcggacaatgcagagcaa
cttcgcgatctttgcgccaaggcattcgccgccagtccccaggtcctcattgagaagagt
atgaagggttggaaagagatcgagtacgaggtcgttcgtgacgcacaagacaactgtatt
actgtttgcaacatggagaacttcgatcccctcggtatccacactggcgattccattgtc
gttgctccttcacagaccctttcggacgaggattacaatatgctccggactacagcggtc
aatgtcattcgacatctcggtgttgtgggtgaatgtaatatccaatatgctctgaaccca
ttctcgaaggagtactgcatcatcgaagtcaatgctcgattgtccagatcttccgcgctt
gcctcgaaggcaaccggttacccattggctttcatcgctgccaaacttggccttggtatc
ccattgaatgagatctccaatagcgtcaccaaggttacatgtgcctgcttcgaaccctcc
ctcgattacgtcgtggttaagatccctcgttgggatctgaagaaattcactcgcgtctcc
acccagctcggttcttccatgaagagtgtcggtgaagttatgagtattggcagaactttc
gaagaagccatccaaaaggccattcgtgccgtcgattacactaatctgggctttaacgct
accaatgcgctgatgtccatcaagactgagctccagactccatctgatcagcgtttgttc
gctatcgcaaatgcaatgcactccggctacaccgttgatgatatctgggagctaaccaag
atcgacaaatggttcctacgcaagcttgagggtctcagcaaatttggaaaattaatcagc
actttctccgcctctactgtccctgtctcccttgtccgacaggccaagcagcttggtttc
tccgaccgccagctctccaaattcctgagctctaatgagttggcaatccgccgccttcgt
gttgaggctggtattatgcctgttgtaaaacagatcgacaccgttgctgctgagttcccc
gcttacaccaactatctctatcttacgtataatggctcggagagtgacatttcattcaat
gacaacggcgttatggttcttgggtccggtgtctaccggatcggttcttccgtcgaattc
gactggtgctccgtcagggccattcgcacccttcgagagcaaggacacaagacggtcatg
gtcaactacaaccccgagactgttagtaccgactacgatgaagctgaccgtctgtacttt
gagaatattactttggagaccgtgctcgatatctatcagctggagtcctcgagtggagtc
atcatttccatgggtggccaaacgccaaacaacatcgcgttgcccttgcatcgtttgaac
gtcaacatccttggtacctctcccgagatgatcgacgctgctgaaaaccgctacaagttc
tctcgattgcttgaccgcatcggcgtcgaccaaccagcgtggaaggaactcaccagtatt
gaggaggctacggcattctgtgacaaagtcaaataccctgtgcttgtccgtccgtcctat
gttctgtctggtgctgcaatgaacacggtgtactcccaggacgatttggccaactacctc
aaccaagctgccgaggtctcgagggaccacccagtggttatcacaaaatacattgaaaat
gccaaggaaattgaaatggacgctgtcgcaaagaatggtgtgatggtcggccacttcatc
tccgagcacgtcgagaatgccggcgttcactctggtgatgcgaccctcatcttgccgcca
caagatttggacccggagaccgtccgtcggatcgaggaagccactcgaaagatcggaaac
gccctcaacgtcaccggtccatttaacattcagttcattgccaaggacaatgagatcaag
gttatcgagtgcaacgtacgggcatcgcgatcattcccgttcgtttccaaggttatgaat
gtcgatttgatcgagatggctacaaaggcaatgattggcaagccattcgtcgaataccca
ccagtgaacatcccaaagaactacgtcggtatcaaggtccctcaattctccttctcgcga
ttgtccggtgccgatccagtcctcggtgttgagatggcgtccaccggtgaagtcgcttgt
ttcggtcgcgatcgctacgaagcttacctcaaggcccttatttcaactggcttcaagctt
ccgaacaagaacatccttgtttccatcggttcttacaaggagaagatggagatgcttcct
tcgatcagaaaacttcaccagatgggatacaatctctttgcgactgctggtactgcagac
tttattcgtgagcatggtattccagtgaagtaccttgaacttctcgccggagaagaagag
gatctgaagtcagaatattcccttactcaacatcttgccaacaacttgattgacctttat
atcaaccttccatccagcaataagttcagaagaccggcaaattacatgagtaaaggttac
cggactcgtcgtatggccgtcgactatcagactcctcttgtgacgaatgtgaagaatgca
aagatattgattgaagccatttcccgccaatttgagatggccgtccaacccattgacttc
cagaccagtcatcgtaccgtggttctccctggtctgatcaacgtcgccgcatttgtccct
ggtgttgccaatcccgactcgtcagatttccaatctgtgaccaaggcctctatctctgca
ggattttcgatgattcgcgttatgcctgttggtgtggacagcttcctcacggatgcccgt
gcactgaaaattgcacaacacaatagtcagaaggggacgtggtgcgattataacttgtcc
gtcgctgccacgacgtccaatgcggatcagatcggtcaggtcgctgctgacgtcggctcc
ttgtatatcccgtttaatcacttggctggaaacatcaacaaggttggcactgtcacctcc
cactttgctgcttggccacccacgaaaccgatcatcacggatgccaaggcaactgatctc
gcttcggtcctgcttcttgcaagccttcatagccgggacatccatgtcatgagtgttact
tcgaaggaggatatcaatttaattgccctgagcaaggagaaaggattgcgggtcacctgt
gacgttgcgatttactctctgttcctctccacagaggactacccgcaatgcactcatttg
ccatcgaaagaggaccaggaggctctctgggagcacttgagcaccatcgacatcttctgc
attggaggccttccgtatgaacttgctggaaaggaagccaagccggaggttggaattgcg
gacgcgcttccactactcctgactgctgtttgggaggggcgcctgactcttgatgacgtt
acttctcgactctacgacaaccctaagaggattttcgagctccatgaccagcctgatgcc
tcggttgaaatcgaggtggaccgcccatatgtcttccagagcgaaggagtctggtctcct
ttcaacggcaaaactcttcgaggatcggttcagcgagttaccttccaaggtaagacatct
tgccttgatggtgagttggttggcgatgctgcgcgtggtacggatatgtcagcgcatcgt
cttgctcctccagcatcaccttctatcaaggagccgcccaggtctcctagacgggatgta
tccgtcggacgacgcctctccttctccacaacgcctgttgctcgctcatcgcgcctgaga
ccgtcggacgccgctatcacctcgcctggaaacgagttgggccctccattgtatacccaa
ctactaagcgtcccgacagcgtctccatctttgatggaactgcttgctcagtcttccttc
aagcaaaaacatatcctgtcggtgaaccaatttaatagagcggatcttcaccttctgttc
accgttgcgcaggaaatgcgattgggtgtccagcgccacggcgttcttgatatcctcaag
ggacgggttctgtcaacattgttctatgagccttctacccgcacatcggcctccttcgac
gcagccatgcaacgccttggtggccgcaccgttgccgttgctactgagcattcgtcaact
cagaagggagagtcacttcaggacactgttcgcaccctcgcttgctacgccgatgcgatt
gttcttcgccacccgctcgagagcagcgctgccaccgctgctaggttttctccggttcct
attatcaacggtggtaatggaagtatggagcaccctacccaggctttccttgacctcttc
actatccgagaagaattgggcactgtcagcggcatcacggttactttcatcggtgacttg
cgctacggccgcacggtgcactccttgattaagttgctccagttctacgaggttcgcgta
caactggtggcccctaaggatcttgctctccctgaagatgtccgccaacacctcgtcact
tctggccagcttgttctcgaaaccgaagagctgactcccgaggtcgttgctcgctctgac
gtgttgtactgcacccgcgtacaaaaggaacgcttcgaggacctgaaggagtacgagcga
ctcaagaatagtttcgttgtggataactctgtgctcaagcatgcgaagagccagatggtt
gtgatgcaccctcttccaagaaacgcagagattggtgaagaggtggactttgatcagcgg
gcttcgtattttagacagacgagatacggcctctactgtcgcatggcgttgttggctttg
gtgatggcaccttga

DBGET integrated database retrieval system