KEGG   Coccidioides immitis: CIMG_09966Help
Entry
CIMG_09966        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
cim  Coccidioides immitis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cim00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CIMG_09966
Messenger RNA biogenesis [BR:cim03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     CIMG_09966
Translation factors [BR:cim03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CIMG_09966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 739 aa AA seqDB search
MAPSFDTLSEQDLHEEEVEIDFSDLKAQYEVRLEEGLDAFVVIDGLPVVPEESKPKLIKF
LLKKLNTVGRTREDAIFMPLNEKGMSEGFAFVEYDTPEQAIAATKHLHGTPLDKKHTLAV
NKLTDIDRYGREGRVDEEYTPPKIEPFQEKEHLRSWLGDPNARDQFAMYRGDKVGVFWNM
KNNPPENVVDRDHWTQLFVQWSPLGTYLASVHPQGVQLWGGPQFGKQKQFPHPFVSLMEF
SPGEKYLTTWSSRPIQLDGPPGALSYEEEGKNIIIWDITTGKPLRSFVSHELAAPAGPDG
DAAQAKKKVQWPAFKWSADEKFVARMLPGQSISIYELPRMNLLDRTSVKIEGVMDFEWSP
ATVQREGVKQSEQLLSFWTPEIGSNPAKVGLMSIPSKEVVRTRNLFNVSDVKLHWQSQGA
YVCVKVDRHSKSKKSLATNLEIFRVREKGVPVEVVDSLKDTVINFAWEPKGNRFVLITTG
EVPTGTAVPPKTAVSFFAPEKTKSGAAGNFKLVRTIEKKTSNGIYWSPKGRFVVVATVHS
QQHFDIDFWDLDFEGEKPENEKDLSANLQLMKTNEHFGVTDIDWDPTGRYVVSSASAWTH
SLENGYHIHTFSGTTLTEHAVEKFKQLVWRPRPPTLLSKEEQKKVRRNLREYSREFDEED
KYAVDIANTAIVEMRKRLLNEWTAWLKKEKEMVEEEREVLGLPKYEEEPAAKPTPGAEDD
TIVEEIVEEIIEESEEIVA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaagttttgatactctctcggagcaagacctccacgaggaagaggttgagatc
gacttttcagatctgaaagcgcaatatgaggtccgactggaagagggcctcgacgccttt
gttgtgatcgacggacttccagtcgtccccgaagaaagcaaaccaaaactcatcaagttc
ttgttgaaaaaattaaacaccgtcggcagaacgagagaagatgccatcttcatgcccctc
aacgagaagggcatgtctgaaggctttgccttcgttgaatacgacaccccggaacaggca
atcgccgctacgaaacacctacacggcactcccctggataagaagcatactttggcggtc
aacaagctgaccgacattgatcgctatggacgagagggccgtgtcgacgaggaatatacc
ccgccaaaaatcgagccgttccaggagaaggagcatctgcgatcctggctcggagacccc
aacgcccgtgaccaattcgccatgtacagaggcgacaaggtcggcgttttctggaacatg
aagaacaacccgcccgagaacgtcgtcgaccgcgaccactggactcagctcttcgtgcaa
tggtctcccctcggtacctacctcgcctccgtgcatccccagggcgtacagctgtggggc
ggcccccagttcggcaaacagaagcagttccctcatcctttcgtttctctgatggaattc
tcgcccggtgaaaaatacttgactacctggtccagccgtccgatccagcttgacggacct
cccggtgcgctctcctacgaggaggaagggaaaaacattataatctgggacatcacgacc
ggaaagccacttcgatcattcgtttcccacgagctcgctgctcccgctgggcctgacggt
gacgctgcccaggccaagaagaaggtgcagtggccggccttcaaatggtcggccgatgag
aagtttgtcgctcgcatgctcccaggccaatccatctccatctacgaactaccccgcatg
aatcttctggatagaacatcggtcaagattgaaggtgtcatggacttcgaatggtcccca
gcgaccgttcaacgtgaaggagtcaagcagtctgaacagctactctccttctggacccct
gagatcggtagcaatcctgccaaggtcggcttgatgagcatcccctccaaggaagttgtc
cgaacacgaaatcttttcaatgtttccgatgtcaagttacattggcaatcccagggagca
tacgtctgcgtcaaggtcgacagacattccaagtccaagaagtcgttggccaccaacctc
gagatcttccgtgttcgcgagaaaggtgtccccgtcgaagtcgtcgactcgctcaaggat
accgtcattaacttcgcttgggagcctaagggcaaccgcttcgttctcatcaccactgga
gaggtacctactggcaccgctgttcccccaaaaactgcagtctcgtttttcgctcccgag
aagacaaagagtggtgctgctggtaacttcaaactcgttcgtaccatcgaaaagaagact
agtaacggcatttactggtcacctaagggtagattcgtcgttgttgctactgtccactct
caacagcacttcgatattgatttctgggatctcgactttgaaggcgagaagccggaaaat
gagaaggatttgagtgcaaacctgcagctaatgaagactaacgagcactttggcgtcact
gatattgattgggacccaacaggccgttatgttgtctctagcgccagtgcctggactcac
tcgctcgaaaacgggtaccatatccacaccttctccggaaccacactcacagaacatgct
gttgagaaattcaagcaactagtctggcgcccacgacccccaacacttctctccaaggag
gaacaaaagaaggtccgacgaaacctccgtgagtactcccgcgaattcgacgaagaagac
aagtacgccgtcgacatcgcgaataccgctattgtcgagatgcgtaagagactgcttaac
gaatggaccgcctggctcaagaaggagaaggagatggtcgaagaggagcgtgaagttctg
ggactgcccaagtacgaagaagaaccggctgccaaacctactcccggtgccgaagacgat
actattgtggaggaaattgtggaagagatcatcgaggaatcggaggagattgttgcatga

DBGET integrated database retrieval system