KEGG   Coccidioides immitis: CIMG_09981Help
Entry
CIMG_09981        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
cim  Coccidioides immitis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cim00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1388 aa AA seqDB search
MGKFPADWNKHLQGIGQRGYNVVHFTPLMTRGASNSPYSIYNQLEFDRQCFPNGESDVID
MVTRMEKEYGLLALTDIVWNHTAHNSKWLQEHPEAGYNVETAPWLEAALELDDALLSYGN
ALQSLDLPTEFKTVEDLVSVMQQMRPHVIEKIKLWEFYSVNVQRDTEAIIKAWKSGNLDY
PKGGFGDVGVGGLSEIRQWPFERKAAFLREKALENDNQILGRYSRKVNPRIGAALITALY
GRYDETTADIPVVEENVFKTLDSLNLPLFREFDDDVSEIFDQLFHRIKYLRLDDHGPKLG
PVTPKNPLVETYFTRLPLNDITKAHSPRSLALVNNGWVWNADALRDNAGPGCRAYLKREV
IVWGDCVKLRYGNCPEDNPFLWDYMTRYTKLMAKHFAGFRIDNCHSTPLPVAEYLLHEAR
RIRPNLMVYAELFTGSEKVDYLFTKRLGLTALIREAMQAWSAAELSRLVHRHGGLPIGSF
DPSLLSHWCQMETKVVLHHIRPTTVHALFMDCSHDNETPAQKRDPRDTLPNAALVAMCAS
AIGSVMGYDEIYPEHVNLVTETRSYHSVFSENGVQDATGEGGIGGIKKLLNSLHTEMAIE
EYDETHIHHDAEYITVHRVHPHTRKGTLLISRTAFSASNVKHILAPIHLTGTKASLLGAW
KLEVENDTEAKRIVAADEKYLRGLPSRVSEISGFRIEENGDDTIIYTPDDFPPGSIALLK
THIHERDLPVGLSEFITADADATFRSVDLTGLNFTLYRCDSEERESSGGKDGVYKIPNFG
PLVYAGLQGWWSVLEEIIKTNDLGHPLCDNLRAGQWALDFVVGRMRRAITQQGYSQLEGP
TKWLEDRFNAVRRVPNFLLPRYFTIIIKAAYDAACRHAIHCLGVIIEHGQHFIHELALVS
VQQMGEVKSASLYPTKQVPCLAAGLPHFATDWARCWGRDVFISLRGLLLATGRFDDAKEH
ILAFASTLKHGMIPNLLSSGKFPRYNSRDSVWFFLQAIQDYTHIVPNGIRILEENVPRRF
LPYDDTWFPFDDKRAYSRSSTIAEIIQEVFQRHASGISYREHNAGPELDLQMKPEGFQVD
VHVDWETGIIFGGNRWNCGTWMDKMGESVKAKNQGYPGTPRDGAPIEISGLLYSALRWVS
DLRRKGHYPYSGVDIESGLTITFDDWATRVKTHFEKCYYVPVDSEEDRDFNVDSKLVNRR
GIYKDIYKSSQPYEDYQLRPNFTIAMTVAPDLFDAERGFHALTIADVVLRGPLGMATLDP
TDLNYRPYYNNSEDSTDFATSKGRNYHQGPEWLWPTGYFLQALLKFSLLRNSSHQSLMDI
SQQITMRLERCCKSLRESTWKGLTELTNKNGEFCVDSSPTQAWSAACLLALYYDASEIQK
ARSASLSV
NT seq 4167 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagttcccggcggattggaacaagcatcttcagggaattgggcaacggggatat
aatgttgttcattttacgcccttaatgactcgaggggcgtcaaattctccgtacagcata
tacaaccagttagaatttgatcgccaatgttttccgaatggagaaagcgatgttatagat
atggtcacgagaatggaaaaggagtacggactgcttgcattgactgatattgtatggaac
catacagcacataacagcaaatggctccaggaacatcccgaagctggctataatgtggaa
actgccccttggttagaagctgccctggagttggacgacgctctgttaagttatggaaat
gcgttgcaaagtctagatttacccacagagtttaaaaccgtcgaggatctggtttccgtc
atgcagcagatgaggccacatgttattgaaaagattaagctttgggaattttactcggtc
aatgttcagcgtgatacggaggcaatcatcaaagcctggaaatctggcaatcttgattat
ccaaaaggcggcttcggggatgtcggagtaggaggcttaagcgaaattcgacagtggccg
tttgaaaggaaagctgctttcctacgtgaaaaggcacttgaaaatgacaaccagatttta
gggagatacagcagaaaagtaaatcctcgaatcggtgctgcactcatcactgcgctatac
ggtcgatacgacgaaacgacagcagatatacctgtcgtggaagagaatgtcttcaaaact
ctggattctctgaatttgccactgttcagagagtttgacgacgacgtctcggaaatattt
gaccagttattccataggatcaagtatctacgcctcgatgaccatgggcctaagctgggc
cccgtcactccaaagaatccactcgtcgaaacgtattttactcgtcttccgttgaatgat
atcactaaagcgcatagcccaaggtcgcttgccttggttaacaacgggtgggtgtggaat
gccgacgctttaagggacaacgctgggccgggttgtcgggcatacctaaaacgtgaagtt
atcgtttggggggactgcgttaaactgcgttatgggaattgtccggaggataatccattt
ttatgggactacatgactcgatatacaaagttaatggcgaaacattttgcaggatttcgc
attgataactgtcactccacacccctgcccgttgcggaatacttgttacatgaggctcgg
cgtattcgtccgaacttaatggtttatgcggagctattcacgggttctgagaaggttgat
tatttatttacaaaacgacttggattgacagcgttgattagagaagctatgcaggcatgg
agcgctgctgagttaagtcgattggttcatcgccacggtggtcttccaattggcagtttt
gatccaagcttgttatctcactggtgtcaaatggagaccaaagttgtcctccaccatatt
cggccaactacggtgcatgctcttttcatggattgttctcatgataatgaaactcctgct
caaaagcgagatccgagggatacattgcccaatgcagctctggtcgcaatgtgcgcttct
gcgattggaagtgtcatgggttacgatgagatatatcctgagcatgtgaatctcgtcact
gaaactcgctcataccattcagtcttttcagaaaacggcgtccaagacgccactggcgaa
ggaggtattggtggaataaagaagcttttgaacagcctgcatacagagatggcgattgag
gaatatgatgagactcatattcaccacgatgcagagtacataacggttcacagggtacat
ccacacacgagaaaagggacactacttatatcacgtaccgcattttctgcgtctaatgtt
aagcacatcctcgctccaattcacttaacgggcaccaaagcatcacttttaggggcctgg
aaattggaagttgagaatgataccgaagctaagcgaattgtagccgctgatgagaagtac
ctgaggggtctgcccagccgtgtttctgaaatatctgggtttcggattgaagagaatgga
gacgatacgataatatatacccccgatgattttccaccgggctcaattgctttactaaaa
acacatatccatgaaagagatttaccggtgggcctgagtgaatttatcaccgctgatgca
gatgcaactttccgctctgttgatcttaccggcctgaatttcaccttgtatcgctgtgat
tccgaggaaagagagtccagcggcgggaaggacggagtctacaagatcccaaattttggc
cctcttgtttatgctggccttcagggatggtggagtgttctcgaagagataattaaaacg
aatgacctaggtcatccactctgtgataatcttagagccggccaatgggcgcttgatttt
gtcgtcggaaggatgcggcgggctatcacgcaacagggttactcacaacttgaaggaccg
acaaagtggctcgaagacagattcaacgctgtacgtcgagtaccaaatttcttgctgccc
cgatacttcaccatcattatcaaggctgcatacgatgcagcttgcagacatgcaattcat
tgtctcggggttattattgagcatggacaacatttcattcacgaactggcgctggttagc
gtacagcagatgggggaggtcaagtctgcttcactttatcccacaaagcaggtgccttgc
cttgctgccggtcttcctcattttgcaacagactgggcgagatgctggggccgcgatgtc
ttcatttcgcttcgtgggttactcctcgccactggacgctttgacgatgcaaaagagcat
atccttgcctttgcaagcacgttaaaacatggcatgatacccaacttactttcgtctgga
aagttccctagatacaactctcgtgattccgtttggttcttcttgcaggctattcaagat
tatacccatatcgttcccaatggtattcgaattctggaggaaaatgttcctcgacgattc
ttaccctacgatgatacttggtttccgtttgacgataagagagcgtatagtagaagttcg
acgatcgcggaaattatccaggaggtcttccagaggcatgcatcgggtatctcgtatagg
gagcacaacgctggtccggagctggacttgcagatgaagcccgagggatttcaggtggat
gtccatgttgactgggagaccgggattatattcggagggaatcggtggaattgcgggaca
tggatggataaaatgggagagagcgtaaaggctaaaaaccagggatatccaggtactcca
agagacggcgcaccgattgaaatttctgggttgctctacagtgcgctgcgctgggtgtcc
gatctacggagaaagggccactacccgtactcaggcgttgacattgagtctggactaaca
attactttcgatgactgggcaacgagggtcaaaacacacttcgaaaagtgctactatgtc
cctgtggactctgaggaagaccgggacttcaacgtggacagcaaactcgtgaaccgtcgc
ggaatatacaaggatatatataaatctagtcaaccttatgaggactatcagctccgcccc
aactttactattgcgatgactgttgcacctgaccttttcgatgcagaaagggggtttcat
gctctgaccatcgctgacgttgtccttcgcgggccactggggatggcaacgcttgacccg
accgacctgaactacaggccatattataacaactcggaagactctaccgattttgcaact
tcgaaggggaggaactatcatcagggccccgaatggttatggccaactgggtactttctc
caagcgctgttgaagttttctctgttgaggaatagttcacatcagagcttgatggacata
tcccagcagattaccatgcgactggagagatgctgcaaatccctgagggagagtacatgg
aaaggtctgacagaattgacgaataagaacggggaattttgtgttgattcgtcaccgacc
caggcgtggtctgcagcgtgtttgctggccctgtattatgatgcttctgagatccagaag
gcaaggtcggcttccttgagtgtctaa

DBGET integrated database retrieval system