KEGG   Coccidioides immitis: CIMG_09981Help
Entry
CIMG_09981        CDS       T01114                                 

Definition
(RefSeq) glycogen debranching enzyme
  KO
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
cim  Coccidioides immitis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CIMG_09981
Enzymes [BR:cim01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CIMG_09981
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     CIMG_09981
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1605 aa AA seqDB search
MRDSPVSHLTSYHANLVFPSTHPSTLLSPAIDCHCAQLGDHRGPENNLGACGWATALVIV
CIILTQHGDPNSRVFASVGQRWRSRCSGRFYLPPSSDPSPISASLRESALKATNSGNSSK
DPFALLIIYNRKLMVNYGLKPVFNREFKIDIPITCAGAFSFYITYSLLPKLSDSFAPSPQ
TEIRTETYYIDVCPDIRLNGKRMPVESLSIFSIVSKFMGKFPADWNKHLQGIGQRGYNVV
HFTPLMTRGASNSPYSIYNQLEFDRQCFPNGESDVIDMVTRMEKEYGLLALTDIVWNHTA
HNSKWLQEHPEAGYNVETAPWLEAALELDDALLSYGNALQSLDLPTEFKTVEDLVSVMQQ
MRPHVIEKIKLWEFYSVNVQRDTEAIIKAWKSGNLDYPKGGFGDVGVGGLSEIRQWPFER
KAAFLREKALENDNQILGRYSRKVNPRIGAALITALYGRYDETTADIPVVEENVFKTLDS
LNLPLFREFDDDVSEIFDQLFHRIKYLRLDDHGPKLGPVTPKNPLVETYFTRLPLNDITK
AHSPRSLALVNNGWVWNADALRDNAGPGCRAYLKREVIVWGDCVKLRYGNCPEDNPFLWD
YMTRYTKLMAKHFAGFRIDNCHSTPLPVAEYLLHEARRIRPNLMVYAELFTGSEKVDYLF
TKRLGLTALIREAMQAWSAAELSRLVHRHGGLPIGSFDPSLLSHWCQMETKVVLHHIRPT
TVHALFMDCSHDNETPAQKRDPRDTLPNAALVAMCASAIGSVMGYDEIYPEHVNLVTETR
SYHSVFSENGVQDATGEGGIGGIKKLLNSLHTEMAIEEYDETHIHHDAEYITVHRVHPHT
RKGTLLISRTAFSASNVKHILAPIHLTGTKASLLGAWKLEVENDTEAKRIVAADEKYLRG
LPSRVSEISGFRIEENGDDTIIYTPDDFPPGSIALLKTHIHERDLPVGLSEFITADADAT
FRSVDLTGLNFTLYRCDSEERESSGGKDGVYKIPNFGPLVYAGLQGWWSVLEEIIKTNDL
GHPLCDNLRAGQWALDFVVGRMRRAITQQGYSQLEGPTKWLEDRFNAVRRVPNFLLPRYF
TIIIKAAYDAACRHAIHCLGVIIEHGQHFIHELALVSVQQMGEVKSASLYPTKQVPCLAA
GLPHFATDWARCWGRDVFISLRGLLLATGRFDDAKEHILAFASTLKHGMIPNLLSSGKFP
RYNSRDSVWFFLQAIQDYTHIVPNGIRILEENVPRRFLPYDDTWFPFDDKRAYSRSSTIA
EIIQEVFQRHASGISYREHNAGPELDLQMKPEGFQVDVHVDWETGIIFGGNRWNCGTWMD
KMGESVKAKNQGYPGTPRDGAPIEISGLLYSALRWVSDLRRKGHYPYSGVDIESGLTITF
DDWATRVKTHFEKCYYVPVDSEEDRDFNVDSKLVNRRGIYKDIYKSSQPYEDYQLRPNFT
IAMTVAPDLFDAERGFHALTIADVVLRGPLGMATLDPTDLNYRPYYNNSEDSTDFATSKG
RNYHQGPEWLWPTGYFLQALLKFSLLRNSSHQSLMDISQQITMRLERCCKSLRESTWKGL
TELTNKNGEFCVDSSPTQAWSAACLLALYYDASEIQKARSASLSV
NT seq 4818 nt NT seq  +upstreamnt  +downstreamnt
atgcgagactcaccggtcagtcacctgacgtcatatcatgcgaaccttgtctttccctct
actcatccctcgaccttgctttcaccagctatagactgccattgtgcgcaactcggcgac
catcgtggcccagagaataaccttggggcctgtggctgggctacggcccttgtgatcgtt
tgcataattctcacccagcatggcgacccgaactcacgtgtatttgcttccgttggccaa
cgatggcgctccagatgttccgggaggttttatctacctccctcctccgacccatccccc
atatctgcttcgctccgggagagtgctttaaaagcaacaaattcagggaattcaagtaag
gacccgttcgccttgctcatcatttacaaccgtaaactgatggtaaattatggactgaaa
ccggtattcaaccgagagttcaagattgatatcccaattacgtgtgcaggagccttttcc
ttctatatcacttacagccttcttcccaaactctcggactcgttcgcaccttcgccccaa
accgaaataagaacggagacgtactatatagatgtgtgtccggatattaggcttaatggc
aaacgaatgcccgtcgagtctctttcgatattctctatcgtctccaaattcatgggcaag
ttcccggcggattggaacaagcatcttcagggaattgggcaacggggatataatgttgtt
cattttacgcccttaatgactcgaggggcgtcaaattctccgtacagcatatacaaccag
ttagaatttgatcgccaatgttttccgaatggagaaagcgatgttatagatatggtcacg
agaatggaaaaggagtacggactgcttgcattgactgatattgtatggaaccatacagca
cataacagcaaatggctccaggaacatcccgaagctggctataatgtggaaactgcccct
tggttagaagctgccctggagttggacgacgctctgttaagttatggaaatgcgttgcaa
agtctagatttacccacagagtttaaaaccgtcgaggatctggtttccgtcatgcagcag
atgaggccacatgttattgaaaagattaagctttgggaattttactcggtcaatgttcag
cgtgatacggaggcaatcatcaaagcctggaaatctggcaatcttgattatccaaaaggc
ggcttcggggatgtcggagtaggaggcttaagcgaaattcgacagtggccgtttgaaagg
aaagctgctttcctacgtgaaaaggcacttgaaaatgacaaccagattttagggagatac
agcagaaaagtaaatcctcgaatcggtgctgcactcatcactgcgctatacggtcgatac
gacgaaacgacagcagatatacctgtcgtggaagagaatgtcttcaaaactctggattct
ctgaatttgccactgttcagagagtttgacgacgacgtctcggaaatatttgaccagtta
ttccataggatcaagtatctacgcctcgatgaccatgggcctaagctgggccccgtcact
ccaaagaatccactcgtcgaaacgtattttactcgtcttccgttgaatgatatcactaaa
gcgcatagcccaaggtcgcttgccttggttaacaacgggtgggtgtggaatgccgacgct
ttaagggacaacgctgggccgggttgtcgggcatacctaaaacgtgaagttatcgtttgg
ggggactgcgttaaactgcgttatgggaattgtccggaggataatccatttttatgggac
tacatgactcgatatacaaagttaatggcgaaacattttgcaggatttcgcattgataac
tgtcactccacacccctgcccgttgcggaatacttgttacatgaggctcggcgtattcgt
ccgaacttaatggtttatgcggagctattcacgggttctgagaaggttgattatttattt
acaaaacgacttggattgacagcgttgattagagaagctatgcaggcatggagcgctgct
gagttaagtcgattggttcatcgccacggtggtcttccaattggcagttttgatccaagc
ttgttatctcactggtgtcaaatggagaccaaagttgtcctccaccatattcggccaact
acggtgcatgctcttttcatggattgttctcatgataatgaaactcctgctcaaaagcga
gatccgagggatacattgcccaatgcagctctggtcgcaatgtgcgcttctgcgattgga
agtgtcatgggttacgatgagatatatcctgagcatgtgaatctcgtcactgaaactcgc
tcataccattcagtcttttcagaaaacggcgtccaagacgccactggcgaaggaggtatt
ggtggaataaagaagcttttgaacagcctgcatacagagatggcgattgaggaatatgat
gagactcatattcaccacgatgcagagtacataacggttcacagggtacatccacacacg
agaaaagggacactacttatatcacgtaccgcattttctgcgtctaatgttaagcacatc
ctcgctccaattcacttaacgggcaccaaagcatcacttttaggggcctggaaattggaa
gttgagaatgataccgaagctaagcgaattgtagccgctgatgagaagtacctgaggggt
ctgcccagccgtgtttctgaaatatctgggtttcggattgaagagaatggagacgatacg
ataatatatacccccgatgattttccaccgggctcaattgctttactaaaaacacatatc
catgaaagagatttaccggtgggcctgagtgaatttatcaccgctgatgcagatgcaact
ttccgctctgttgatcttaccggcctgaatttcaccttgtatcgctgtgattccgaggaa
agagagtccagcggcgggaaggacggagtctacaagatcccaaattttggccctcttgtt
tatgctggccttcagggatggtggagtgttctcgaagagataattaaaacgaatgaccta
ggtcatccactctgtgataatcttagagccggccaatgggcgcttgattttgtcgtcgga
aggatgcggcgggctatcacgcaacagggttactcacaacttgaaggaccgacaaagtgg
ctcgaagacagattcaacgctgtacgtcgagtaccaaatttcttgctgccccgatacttc
accatcattatcaaggctgcatacgatgcagcttgcagacatgcaattcattgtctcggg
gttattattgagcatggacaacatttcattcacgaactggcgctggttagcgtacagcag
atgggggaggtcaagtctgcttcactttatcccacaaagcaggtgccttgccttgctgcc
ggtcttcctcattttgcaacagactgggcgagatgctggggccgcgatgtcttcatttcg
cttcgtgggttactcctcgccactggacgctttgacgatgcaaaagagcatatccttgcc
tttgcaagcacgttaaaacatggcatgatacccaacttactttcgtctggaaagttccct
agatacaactctcgtgattccgtttggttcttcttgcaggctattcaagattatacccat
atcgttcccaatggtattcgaattctggaggaaaatgttcctcgacgattcttaccctac
gatgatacttggtttccgtttgacgataagagagcgtatagtagaagttcgacgatcgcg
gaaattatccaggaggtcttccagaggcatgcatcgggtatctcgtatagggagcacaac
gctggtccggagctggacttgcagatgaagcccgagggatttcaggtggatgtccatgtt
gactgggagaccgggattatattcggagggaatcggtggaattgcgggacatggatggat
aaaatgggagagagcgtaaaggctaaaaaccagggatatccaggtactccaagagacggc
gcaccgattgaaatttctgggttgctctacagtgcgctgcgctgggtgtccgatctacgg
agaaagggccactacccgtactcaggcgttgacattgagtctggactaacaattactttc
gatgactgggcaacgagggtcaaaacacacttcgaaaagtgctactatgtccctgtggac
tctgaggaagaccgggacttcaacgtggacagcaaactcgtgaaccgtcgcggaatatac
aaggatatatataaatctagtcaaccttatgaggactatcagctccgccccaactttact
attgcgatgactgttgcacctgaccttttcgatgcagaaagggggtttcatgctctgacc
atcgctgacgttgtccttcgcgggccactggggatggcaacgcttgacccgaccgacctg
aactacaggccatattataacaactcggaagactctaccgattttgcaacttcgaagggg
aggaactatcatcagggccccgaatggttatggccaactgggtactttctccaagcgctg
ttgaagttttctctgttgaggaatagttcacatcagagcttgatggacatatcccagcag
attaccatgcgactggagagatgctgcaaatccctgagggagagtacatggaaaggtctg
acagaattgacgaataagaacggggaattttgtgttgattcgtcaccgacccaggcgtgg
tctgcagcgtgtttgctggccctgtattatgatgcttctgagatccagaaggcaaggtcg
gcttccttgagtgtctaa

DBGET integrated database retrieval system