KEGG   Coccidioides immitis: CIMG_10106Help
Entry
CIMG_10106        CDS       T01114                                 

Definition
(RefSeq) malate synthase, glyoxysomal
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
cim  Coccidioides immitis
Pathway
cim00620  Pyruvate metabolism
cim00630  Glyoxylate and dicarboxylate metabolism
cim01100  Metabolic pathways
cim01110  Biosynthesis of secondary metabolites
cim01200  Carbon metabolism
Module
cim_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CIMG_10106
   00630 Glyoxylate and dicarboxylate metabolism
    CIMG_10106
Enzymes [BR:cim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CIMG_10106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 4557830
NCBI-ProteinID: XP_001239084
UniProt: J3K0U1
AA seq 539 aa AA seqDB search
MTSVDAQLKDVAILGQISEPARKILTRDACAFLALLHRTFNGTRKALLQRRIARQAELDR
GQLLDFLPETKHIRENDAWKGAPPAPGLVDRRVEITGPTDRKMVVNALNSDVWTYMADFE
DSSAPTWENMVNGQVNLYDAIRRQIDFTQGGKEYKLRTDRKLPTLIARARGWHLDEKHFT
VDGEPISGGLFDFGLYFFHNAHELVKRGAGPYFYLPKMESHLEARLWNDVFNLAQDYIGM
PRGTIRGTVLIETISAAFEMDEIIYELREHSSGLNCGRWDYIFSFIKKFRQNPNFVLPDR
SAVTMTVPFMDAYVRLLIKTCHRRGVHAMGGMAAQIPIKNDPKANDAAMESVRADKLREV
RAGHDGTWVAHPALASIASDIFNKYMPTPNQLFVRREDVHVTANDLLNTNVPGSITEEGI
RKNINIGLSYMEGWLRGVGCIPINSLMEDAATAEVSRSQLWQWARHNVVTAEGKRVDKAY
NLKLLKEQADELASKGPKGNKYQLAARYFASQVTGEDYADFLTSLLYNEISAPGSAAKL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgttgacgctcagctcaaggatgtcgccatcctcggccagatcagcgaaccc
gcacgtaagatcctcaccagagacgcatgcgccttcctggccttgcttcaccgcacattc
aatggaacgagaaaagcacttcttcagcgacgcattgcccgccaggctgaactcgacaga
ggccagcttctagacttcctccctgagaccaagcacatccgtgaaaacgatgcgtggaaa
ggtgctcctcctgcaccgggattggtcgatcgccgcgttgagattacgggtccgacggac
cggaagatggtggttaatgcgctgaattcggatgtatggacgtatatggctgattttgaa
gattcgagcgctccaacatgggaaaacatggtcaatggccaggttaacctttatgatgct
atccgtcgtcagatcgacttcacccagggaggaaaggaatataaactccgcaccgacaga
aaattgcccacacttatcgcccgtgctagaggttggcatttggatgagaagcatttcacc
gtcgatggcgagcctatctccggtggtttgttcgatttcggtctttacttcttccacaat
gcccacgagttggtgaagagaggcgctggcccatacttctatcttccaaagatggaatcc
cacttggaagcccgcctatggaatgatgttttcaacttggcacaggactatattggcatg
cccagaggcaccatccgtggaactgtccttattgagacgatctctgctgccttcgagatg
gacgagatcatctatgaactccgagagcacagttcaggtctgaactgcggcagatgggac
tacatcttctcgttcatcaagaaattccgccagaatcccaactttgtcctccccgaccgt
tctgctgttaccatgactgtgccgttcatggatgcctatgtcaggcttttgatcaagacc
tgccacagacgaggtgtccacgcgatgggtggtatggctgctcaaatccccatcaagaat
gatcccaaggccaacgacgctgccatggagagcgttcgcgccgacaagctccgtgaggtg
cgcgctggtcatgacggcacatgggttgctcacccagcccttgcatctattgcttccgac
atcttcaacaagtacatgccaactcctaaccaactcttcgtccgaagggaggatgtacat
gttactgccaatgatctcctaaataccaacgtccccggtagcatcactgaggaaggaatc
agaaagaacatcaacattggcctttcatacatggagggatggctccgtggtgttggatgt
atcccaatcaacagcctgatggaggatgccgccaccgctgaagtcagccgaagccagctc
tggcagtgggcccgccacaacgttgttactgctgagggcaagagggtcgacaaggcttac
aacttgaagctcctgaaggagcaagccgacgagctcgcctccaagggtcccaagggcaac
aaataccagcttgccgctcgctacttcgccagccaggttactggagaagattatgcagat
ttcttgacctcgttgttgtacaatgagatctctgctcctggaagtgcagccaagctgtaa

DBGET integrated database retrieval system