KEGG   Coccidioides immitis: CIMG_10137Help
Entry
CIMG_10137        CDS       T01114                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
cim  Coccidioides immitis
Pathway
cim00630  Glyoxylate and dicarboxylate metabolism
cim01100  Metabolic pathways
cim01110  Biosynthesis of secondary metabolites
cim01200  Carbon metabolism
Module
cim_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CIMG_10137
Enzymes [BR:cim01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CIMG_10137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL PEP_mutase DUF2458 AAA_7
Motif
Other DBs
NCBI-GeneID: 4558173
NCBI-ProteinID: XP_001239115
UniProt: J3K0W3
AA seq 601 aa AA seqDB search
MLRNASRCLSRQLRQAARPSVVPRCSVAGRLAYTSVRMVSQLPPVKPPVSVEFPADSYQL
LSTSEKAGAAEDALFEQEVNAVKEWWASPRYEGIKRPYSAEDVVSKRGSLQQSYPSSLMA
RKLFNLLNDKAAKGEPLHTLGAIDPVQMTQQAPNQEVLYISGWACSSLLTTTNEVSPDFG
DYPYNTVPNQVQRLFKAQQMHDRKHWDARRKMTAEQRKATQYVDYMRPIVADGDTGHGGL
TAVMKLAKLFAENGAAAVHFEDQLHGGKKCGHLAGKVLVPISEHINRLVAARFQWDLMGT
ENLVIARTDSESGKLLSSTIDVRDHEFILGVTQDTAPLSEELQKMELEGASGAEIDKFEM
KWVKEHKLVTFDEAVEQHLVSEGASKTTIDEYKAKVRENRDMSISERRAFADTLAKCPVF
WSWDIPRTREGFYHYRAGEAAATKRAINFAPYADLLWVETGDPNVSKAAGFAAEIRNKFP
GKKLVYNLSPSFNWMGQGFDEASLKSFIWDLAKHGFVLQLISLAGLHTNATIATELSRGF
KKDGMLSYVNLVQKREKEMGVDVLTHQKWSGAPYVDGVLGSILSGSSSNKSMGEGNTESG
F
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcaacgcttcccgctgcctgtcgagacagctccgacaagctgcacgtccctct
gtcgtccctcgctgctctgtcgctggacgtctggcctatacctccgtcagaatggtctcg
cagcttcctccggtcaagccaccggtgtctgttgaattccccgcagactcgtaccagctg
ctgtccacgtcggagaaggccggcgccgctgaagatgccctcttcgagcaggaggtgaac
gccgtcaaggagtggtgggcttctccccgctacgagggcatcaaacggccctattccgca
gaggacgtcgtcagcaagagaggatccttgcagcagtcatatccaagctcgttgatggct
agaaaactgttcaatctactcaacgacaaggctgccaaaggggaaccgctgcacaccctt
ggcgcaatcgaccctgtacagatgacgcagcaggctcccaaccaggaagtgttgtacatc
tccggatgggcttgctcttccctcctgacgaccacaaacgaggtctccccggatttcggt
gactatccgtacaacaccgttccgaaccaggtgcagcgattgttcaaggcccagcagatg
cacgatcgcaagcactgggatgccagacggaagatgactgctgagcagagaaaggctact
caatacgtcgactatatgcgcccaatcgttgcagacggtgacacagggcacggaggcctg
acggcggtgatgaagctcgctaagctcttcgccgagaacggcgccgcggccgtccacttc
gaggaccaacttcacggaggcaagaagtgcggccacctcgctggaaaggtcttggttcca
atctccgagcatatcaatcgcctggtggctgccaggttccaatgggatctcatgggaacc
gagaatttagtcattgctagaaccgactctgaaagcgggaagcttctcagcagcaccatc
gatgttcgagaccacgaattcattcttggagttacacaggataccgcgccactgtcggaa
gagttacagaagatggagctcgaaggcgcttcgggtgccgagatcgataaattcgaaatg
aaatgggttaaggaacataaactggtgacatttgacgaggctgtggaacaacatctcgtc
tccgaaggagcctccaagaccaccattgacgaatacaaggcaaaggttcgcgaaaacaga
gacatgtccatttcagaacgccgggccttcgcagacaccctcgcgaaatgcccggtcttc
tggtcatgggacatcccaagaacccgagaaggtttctaccattatcgcgccggtgaagca
gcggccaccaagcgcgccatcaacttcgctccctacgctgatctcctctgggttgaaacc
ggcgacccgaacgtcagcaaggcagctggatttgccgccgagatccgaaacaagttcccc
ggaaagaagctggtctacaaccttagcccgtcgtttaactggatgggacagggctttgac
gaggccagcctgaaatcattcatctgggacctcgccaaacatggattcgttctccaactc
atctcgcttgccggtctgcacaccaacgctactatcgcaacggagctctcaagagggttc
aagaaagatggcatgctatcatatgttaatcttgtccagaaacgcgaaaaagagatgggc
gttgatgttctgacccaccagaagtggagtggtgctccctacgtcgatggagttctgggc
tccattctcagcggcagcagctcgaacaagagcatgggcgaaggaaacacagagtcaggt
ttctaa

DBGET integrated database retrieval system