KEGG   Coccidioides immitis: CIMG_10137Help
Entry
CIMG_10137        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cim  Coccidioides immitis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:cim01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:cim00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 610 aa AA seqDB search
MLRNASRCLSRQLRQAARPSVVPRCSVAGRLAYTSVRMVSQLPPVKPPVSVEFPADSYQL
LSTSEKAGAAEDALFEQEVNAVKEWWASPRYEGIKRPYSAEDVVSKRGSLQQSYPSSLMA
RKLFNLLNDKAAKGEPLHTLGAIDPVQMTQQAPNQEVLYISGWACSSLLTTTNEVSPDFG
DYPYNTVPNQVQRLFKAQQMHDRKHWDARRKMTAEQRKATQYVDYMRPIVADGDTGHGGL
TAVMKLAKLFAENGAAAVHFEDQLHGGKKCGHLAGKVLVPISEHINRLVAARFQWDLMGT
ENLVIARTDSESGKLLSSTIDVRDHEFILGVTQDTAPLSEELQKMELEGASGAEIDKFEM
KWVKEHKLVTFDEAVEQHLVSEGASKTTIDEYKAKVRENRDMSISERRAFADTLAKCPVF
WSWDIPRTREGFYHYRAGEAAATKRAINFAPYADLLWVETGDPNVSKAAGFAAEIRNKFP
GKKLVYNLSPSFNWMGQGFDEASLKSFIWDLAKHGFVLQLISLAGLHTNATIATELSRGF
KKDGMLSYVNLVQKREKEMGVDVLTHQKWSGAPYVDGVLGSILSGSSSNKSMGEGNTEFL
NLEIPTDVET
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcaacgcttcccgctgcctgtcgagacagctccgacaagctgcacgtccctct
gtcgtccctcgctgctctgtcgctggacgtctggcctatacctccgtcagaatggtctcg
cagcttcctccggtcaagccaccggtgtctgttgaattccccgcagactcgtaccagctg
ctgtccacgtcggagaaggccggcgccgctgaagatgccctcttcgagcaggaggtgaac
gccgtcaaggagtggtgggcttctccccgctacgagggcatcaaacggccctattccgca
gaggacgtcgtcagcaagagaggatccttgcagcagtcatatccaagctcgttgatggct
agaaaactgttcaatctactcaacgacaaggctgccaaaggggaaccgctgcacaccctt
ggcgcaatcgaccctgtacagatgacgcagcaggctcccaaccaggaagtgttgtacatc
tccggatgggcttgctcttccctcctgacgaccacaaacgaggtctccccggatttcggt
gactatccgtacaacaccgttccgaaccaggtgcagcgattgttcaaggcccagcagatg
cacgatcgcaagcactgggatgccagacggaagatgactgctgagcagagaaaggctact
caatacgtcgactatatgcgcccaatcgttgcagacggtgacacagggcacggaggcctg
acggcggtgatgaagctcgctaagctcttcgccgagaacggcgccgcggccgtccacttc
gaggaccaacttcacggaggcaagaagtgcggccacctcgctggaaaggtcttggttcca
atctccgagcatatcaatcgcctggtggctgccaggttccaatgggatctcatgggaacc
gagaatttagtcattgctagaaccgactctgaaagcgggaagcttctcagcagcaccatc
gatgttcgagaccacgaattcattcttggagttacacaggataccgcgccactgtcggaa
gagttacagaagatggagctcgaaggcgcttcgggtgccgagatcgataaattcgaaatg
aaatgggttaaggaacataaactggtgacatttgacgaggctgtggaacaacatctcgtc
tccgaaggagcctccaagaccaccattgacgaatacaaggcaaaggttcgcgaaaacaga
gacatgtccatttcagaacgccgggccttcgcagacaccctcgcgaaatgcccggtcttc
tggtcatgggacatcccaagaacccgagaaggtttctaccattatcgcgccggtgaagca
gcggccaccaagcgcgccatcaacttcgctccctacgctgatctcctctgggttgaaacc
ggcgacccgaacgtcagcaaggcagctggatttgccgccgagatccgaaacaagttcccc
ggaaagaagctggtctacaaccttagcccgtcgtttaactggatgggacagggctttgac
gaggccagcctgaaatcattcatctgggacctcgccaaacatggattcgttctccaactc
atctcgcttgccggtctgcacaccaacgctactatcgcaacggagctctcaagagggttc
aagaaagatggcatgctatcatatgttaatcttgtccagaaacgcgaaaaagagatgggc
gttgatgttctgacccaccagaagtggagtggtgctccctacgtcgatggagttctgggc
tccattctcagcggcagcagctcgaacaagagcatgggcgaaggaaacacagagtttcta
aatctcgaaattcccacggacgttgaaacgtaa

DBGET integrated database retrieval system