KEGG   Ciona intestinalis (sea squirt): 100101830Help
Entry
100101830         CDS       T01056                                 

Gene name
creb/atf-c, ZC3H6, ci-creb/atf-c
Definition
transcription factor Ci-CREB/ATF-c
Orthology
K05870  
cyclic AMP-responsive element-binding protein 1
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Transcription factors [BR:cin03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    100101830 (creb/atf-c)
Mitochondrial biogenesis [BR:cin03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100101830 (creb/atf-c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 298 aa AA seqDB search
METIVADSNVDDRSTATAQIQIQVSGSGETQMVTLPVSMAHAINSAQGQQTVISSQQSGQ
PVAQDTAKRRELLSRRPSYRKILNELSGQPDANQRVKDEPGGSKSSESSESDSGGQMVTP
LQAPTIAYQTGSGTVTVHQSPQTIQIPASALNHDQHVTSVAGLQTFSMANALAQGQAALV
QDSNTSGNTLWMPGNHVVVQGGDSQMYQIRTSTSSNAIPNVVLSGNSMQSPQQMAEEASR
KRELRLMKNREAAKECRRRKKEYVKCLETRVAVLENQNKQLIDELKTLKELYVHKQND
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccattgtagcagactccaatgttgatgatagatctacagctactgcacaaatt
caaatacaagtgtctggttccggcgaaacacagatggtgactttaccagtgtcaatggca
catgcaatcaactcagctcaaggccaacaaacagtcatatcaagtcaacaatcaggccaa
cctgttgctcaggatactgcgaagaggcgagaactgctgtccagaaggccttcctacagg
aaaattttaaacgagttgtcaggacaaccagatgcaaaccaacgagtcaaagatgaacca
ggtggaagcaaatcttcagaaagctccgaatctgactccggtggtcaaatggtaactcca
ttacaagcaccaaccatagcataccaaactgggagtggaacagtgactgtccaccaatct
ccacaaacaattcaaataccggcctctgctttaaaccatgatcaacatgtgacctccgtg
gctggtcttcaaactttctccatggccaacgccctcgcacaaggccaagctgctttagta
caagattccaataccagcggaaacaccctgtggatgccagggaatcatgttgtggtacaa
ggaggcgactcccagatgtaccaaatccgtacctccacttcatcaaatgcaattcctaat
gttgtgttaagtggtaacagcatgcaatcacctcagcagatggcagaagaagcttcaagg
aagcgggaactgaggttaatgaaaaacagagaggcagccaaagaatgccgaaggcggaaa
aaggaatatgtcaagtgtcttgaaactcgtgtggctgtgcttgaaaaccagaacaaacaa
ctcattgacgaactaaaaacattgaaggaactgtacgttcacaaacaaaacgattaa

DBGET integrated database retrieval system