KEGG   Ciona intestinalis (sea squirt): 100169670Help
Entry
100169670         CDS       T01056                                 

Gene name
thbsb
Definition
thrombospondin Bii
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Phagosome
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100169670 (thbsb)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100169670 (thbsb)
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100169670 (thbsb)
  Exosomal proteins of colorectal cancer cells
   100169670 (thbsb)
  Exosomal proteins of bladder cancer cells
   100169670 (thbsb)
Heparan sulfate/heparin binding proteins [BR:cin00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100169670 (thbsb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 973 aa AA seqDB search
MRKLRDLITVSGLLLFSCLSTAQNIADVNLLSSVEQEATQRQLSTKRFQETFTNSEDVFL
IAQFESISQRNSRIFALEQVTPRSHRYRPTSAVELLVNSRTDTVSLKYANNHRGHTLLKF
EGAGISARGRHVLILHFKSTASALRTSRNIKLFVDCSFIREFPRVSGLDEAISSTGPRSQ
IVIGGQHSSDTRTHVIGLRAKFGGTLSDIPETNECRLQTDQFNEFATTIGADNDVATVLA
AQLLQFTRMMTSLKTDMRHMAHETALLRQTIIRCHACGGVDAATDGGSQSIRIPTTPPTD
CDANNPCYQGVQCTQSNSGEVTCGSCPMGMIGDGRDCQDIDECTRANPCSPLTSCVNTEP
GYQCTPCPLGYTGGGAEGVGIDYARSHRQVCTDIDECEIHNGGCGNHSQCVNTAGSFRCG
QCLPGYIGHPSIGCEPMERCGDPARGQIDSCHPYAECLVRRRNPICQCTVGWAGNGFICG
IDSDLDGYPDAALPCTEQTCRKDNCRLTPNSGQEDEDSDRIGNACDDDSDNDGINDIHDN
CPNVPNLDQLNSDSDTMGDACDNCDAVPNFDQSNIDNDQYGDACDVDKDGDGIENRNDNC
PSVPNPNQNDLDNDGLGDICDNCPVHPNPHQTDTDNDRVGEQCDNNLDKDGDGVQDNRDN
CPNVINSSQLDTDNDGIGDDCDDDDDNDGIPDVTPPGPDNCRLVSNFDQRDLNGDGVGDV
CEFDFDADQIEDRFDVCPENAEVHQTDFRMYQTVTLDPLGDAQIDPLWVVQNQGREIIQI
MNSDPGLAIGHTAFKGVDFTGTFYVNTVTDDDYAGFIFAYQDSSSFYTVMWKQSKQTYWQ
STPFRAVAQPGIQLKVVKSETGPGETLRNSLWETGDTPNQVRLLWKDPLDAGWKDRTSYR
WQLIHRPSVGYIRLKMFEGAKLAADSGMILDSTMKGGRLGVFCFSQENVIWSNLQYRCND
TIPNDFFPTGERP
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atgcggaagctgagagacctaattacggtcagtggtttgctgttgttttcctgtttatcc
accgcacagaacatagcagatgtaaacctcttatcctcggtcgagcaagaagccacacaa
agacaactttctaccaaaagattccaagaaacatttacgaattcggaagatgtgtttttg
attgcacagtttgaatcgatttctcaacgaaactctcgcatttttgctctcgagcaagtg
acgccccgctcacaccgttacagaccaacatccgctgttgaactattggtgaacagcagg
accgacaccgtttcgttaaaatacgccaacaaccatcgcggccacacattactcaagttc
gaaggcgctggaatatccgctagaggtcgccatgtgcttatacttcacttcaagtcaaca
gccagtgcattgaggacgtcacgcaatattaaattattcgttgactgctcctttattagg
gaattcccccgcgtttccggcctcgatgaagccatttcatcaactgggcccagatctcag
atcgttattggtgggcaacattcaagtgacactcgcacacacgttattggacttcgtgca
aagtttggcggcacacttagtgatatacctgagacgaacgaatgtcggctgcaaactgat
caattcaatgaatttgccacaacaataggagccgataatgacgtagccaccgtgttggct
gctcagttgctgcagtttactcgtatgatgacgtcactgaaaactgacatgagacacatg
gcgcacgagaccgccctcttgcggcagacgataattcgatgccacgcctgtggtggagta
gatgctgcaacagacggtggaagccaatcaatccgtattcctacgacgccacctaccgac
tgcgatgcgaacaacccatgctatcagggagtgcaatgcactcagagtaacagcggcgag
gtcacgtgtggatcctgtccaatgggaatgatcggcgacggacgtgactgccaagatatt
gacgagtgcactcgtgccaacccatgttcaccactgacaagttgtgtgaacaccgaaccc
ggataccaatgcacgccatgccctcttggttatacgggtgggggcgcggaaggtgtcgga
atagactacgcaagatctcacaggcaagtttgtacagatatagatgaatgtgaaatccat
aatggtggctgtggaaatcactcgcaatgtgttaatacagcgggttcattccgttgcggg
caatgtctaccaggctacataggccacccttcaataggttgtgaaccaatggaaagatgc
ggagatccagcaagaggacaaatagattcatgtcatccttatgctgagtgtttggttaga
cggagaaacccaatatgtcagtgtacagtcggttgggcgggcaacggattcatttgtgga
attgattctgacttggacggatatccagatgcagccctgccatgcactgaacaaacttgt
cgtaaggataattgtagattgacaccgaacagcgggcaggaagacgaggactctgatagg
attggaaacgcgtgcgatgatgattcggataacgatgggataaacgatatacatgataac
tgtcccaacgtaccaaacttggatcagctcaactctgactccgacacaatgggtgacgca
tgtgataattgtgacgcagttcctaattttgaccaatcaaatatcgacaacgatcaatat
ggtgatgcatgtgacgtagacaaagatggcgacggcattgaaaaccgaaacgacaactgc
cctagcgttcctaaccctaatcaaaacgacctcgacaacgatggtcttggagacatatgc
gataactgccctgttcatccgaatccacaccagactgatactgataatgacagagtcggc
gaacaatgcgataataatttggataaagacggtgacggagtccaagacaaccgagataat
tgcccgaacgtaatcaacagttctcaattggacacggataatgacggaataggtgatgat
tgtgacgacgatgacgacaacgatggtatacctgacgtcaccccacctggtccagacaac
tgtcgtctcgtttccaactttgaccaacgtgatttaaacggagacggagtcggtgacgta
tgcgagttcgacttcgacgcagatcagatcgaagacagattcgacgtatgtccggaaaac
gcggaggttcaccaaaccgatttccgaatgtaccagaccgtcacgcttgatccgcttggg
gatgcacagattgatcctttatgggttgtgcagaatcaggggcgtgaaatcatacagata
atgaacagtgatcctgggttggccattggccacaccgcgtttaaaggcgtggatttcacc
ggcacgttttacgtgaacacagttactgacgatgattatgcaggttttatattcgcttat
caggacagcagtagtttctacactgttatgtggaagcaatcaaagcaaacttactggcag
tcgactccgtttcgcgcagttgctcaacctggtatccaactaaaggtggttaagtcagag
actgggccaggtgagacgcttcgtaactctctatgggaaactggggatacaccaaaccaa
gttcgactactatggaaagatcctttagacgctgggtggaaagacagaacatcttatagg
tggcagttaatacatcggccatcagttggatacataaggcttaagatgtttgaaggagca
aaattggctgctgattctggcatgatattggactctactatgaaaggcggtcggttggga
gtgttctgtttttcgcaagagaacgtaatatggtcaaatctacagtacagatgtaacgat
acgattccaaacgactttttcccgactggtgaaaggccatga

DBGET integrated database retrieval system