KEGG   Ciona intestinalis (sea squirt): 100169895Help
Entry
100169895         CDS       T01056                                 

Gene name
ache
Definition
acetylcholinesterase (EC:3.1.1.7)
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cin00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 618 aa AA seqDB search
MLDLSPCVPSLLCCIFVCVIYEVQASSNGLVVQTMYGSVRGKHVESPPRHQRIAAFLGIP
FASPPVGELRFAAPQPPLSWEPDVRQTTEFGNSCVQIDDEVFGNFRGSQMWNAPNLKSED
CLYLNIWTPRIPTSTRSQPLAVMVWIYGGSFYSGTTALALYDGRYLAAQGGVVVVSINYR
LGPLGFLAPLAGTPGNAGLLDQQLALKWVRDNIRAFGGNPDNVTLMGESAGAASIGLHTV
APSSRGLFNRVIFQSGNQMTPWSTISLPTSLNRTRILAANLRCPNPRTSSELDVLTCLRS
HSAVDVFSNSWITQEIFDFPFVPVHGTSFLPEHPHEVTRKGEQADVDVMAGHNTNEGSYF
TLYTVPGFNISSQSILSKKEYIDGIALSGIKTNELGRSGAAFMYADWENPDNVLQYRDGV
NEIVGDFHVVCPTVLLTKRHSRTFSNNNVYLYHLSYRLSNNPWPAWMGVMHGYEIELMFG
TPWFGTSQFTSGYNDVDRSVSRRMVHYWTNFAKFGNPNGLRSANELDLRSTDWPRFDDVR
QRYLEIGIDDDVMGPFPNSFRCAFWERYLPSLKLASSDMDEVETKWKIEFNRWTESMDLW
DRSFKAYSKDGKQSSCPN
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacttatcaccatgtgttccttccctgctatgctgcatattcgtatgtgtaata
tacgaggtccaagcttccagtaacgggctcgtcgttcagacaatgtacggctcggtgcga
ggcaagcacgtggagtcgcccccacgccaccagaggatcgctgcctttctaggaatcccc
ttcgcttctcctcctgtgggtgagttacgcttcgctgctcctcagcccccgctgtcatgg
gaacctgacgtaagacaaacgaccgagttcgggaatagctgcgtacaaatcgacgacgaa
gtgttcgggaatttcagaggttctcagatgtggaatgcccccaatcttaagagcgaggat
tgcctttaccttaacatatggactcccagaataccaacttccacacgttcccaaccacta
gctgtgatggtgtggatatacgggggatccttctacagcgggactacagccttagcctta
tatgatggccgttacctcgctgctcaagggggggtagttgtagtctcaatcaattatcgt
cttggcccgctcggattcctcgctcctttggctggaacacccggcaacgctggcttgctg
gatcaacaacttgcattaaaatgggtgcgagataatataagggcctttggtgggaaccca
gacaacgttaccttgatgggagaaagtgcaggagcagcgtctattggtttgcatacggtg
gccccttccagtcgtggcctgttcaacagagtaatcttccaaagtggtaaccagatgaca
ccatggtccaccatcagcctccctacctctctcaatagaaccagaatccttgctgcaaac
ctacgctgccccaacccgcgtacttcatccgaacttgacgttttaacttgtctcagatcc
cattcagctgtcgacgttttctcaaattcttggattacccaagagatcttcgactttccc
tttgttcccgtacatggaacttcatttctccccgaacatccacacgaggtaactcgtaaa
ggtgagcaagccgacgtcgatgtaatggccggacataacacgaatgaaggttcatatttc
accttatacactgttcccgggtttaatatttcatcgcaaagtattttgtccaagaaagaa
tacattgatggcatcgcattaagtgggattaaaaccaacgagcttggtagatcaggagcg
gctttcatgtatgctgactgggagaacccggataatgtattgcaataccgagacggagtg
aacgaaatagttggagattttcatgtagtttgcccaacggttctgttaaccaaacgccac
tctcgtaccttttccaacaataatgtctacctctaccatctatcgtaccgactttccaat
aacccatggcctgcatggatgggcgtgatgcatgggtatgagattgaactgatgtttgga
acaccctggtttggaacatcacagttcacatcaggttataatgacgtcgatcgctccgtg
agtcgacgtatggtgcattactggaccaacttcgctaaatttgggaacccgaacggttta
cgaagtgcaaacgaactagacttacgtagcactgattggccaagattcgatgacgtcaga
cagcggtatcttgaaattggtatcgacgatgacgtcatggggcctttccctaattcgttt
cgttgcgctttttgggaaagatatttaccatcgttgaaactcgcttcgtccgacatggac
gaagtcgaaacgaaatggaagatcgagtttaacaggtggaccgaatccatggatttgtgg
gatcggtcttttaaagcttattctaaagatgggaaacagagttcttgtcccaactga

DBGET integrated database retrieval system