KEGG   Ciona intestinalis (sea squirt): 100170015Help
Entry
100170015         CDS       T01056                                 

Gene name
sir2-d, Ci-Sir2-d
Definition
silent information regulator protein Sir2-d
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100170015 (sir2-d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 202 aa AA seqDB search
MFTQRCPRCNKEYVMDHVSPTMGLKQTGEKCAEQKTGGRCRGVLCDTILDWEDSLPTDQL
NLSDKFCKAADLAITIGSSLQIVPAANLPLLTKKNGGKVVIINLQQTKHDKKADLLIRGY
ADDIMRIVMNKLNILVPSYTKPVVRLCSDNKIPDSVNLDTRKRRKRKSTDIKKKNETSEI
IQTDIKEPNAPNLGWQGGQANP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgttcacacagcgctgcccacgttgcaacaaagaatatgtgatggatcatgtctcacca
accatgggtttaaaacaaacaggggagaaatgtgccgagcagaagactgggggaagatgc
cgaggtgtattatgcgacacaatattagactgggaagattcactaccaaccgaccaactt
aatttatccgataagttttgtaaagcagctgatctagcaattacaattggttcatcactg
caaattgtacctgcagccaacttacctcttctaacaaagaaaaatggtggaaaagtcgtg
attatcaatctacaacaaaccaaacatgataagaaagcagatttgttaataagagggtat
gctgatgacataatgcgcattgtgatgaacaaactcaacattttagttccttcttacacg
aaacctgttgtacgtttgtgttcggataataaaataccagattctgttaatctggataca
agaaaaaggagaaaaagaaaatcaacagatattaaaaagaaaaatgaaacatctgaaatt
atacaaacagatattaaagagccaaatgcgccaaacctggggtggcagggtgggcaggcc
aacccttga

DBGET integrated database retrieval system