KEGG   Ciona intestinalis (sea squirt): 100170046Help
Entry
100170046         CDS       T01056                                 

Gene name
zf(ubp)-1, Ci-ZF(UBP)-1
Definition
zinc finger (ubiquitin thiolesterase type)-1
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100170046 (zf(ubp)-1)
Peptidases [BR:cin01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100170046 (zf(ubp)-1)
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100170046 (zf(ubp)-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 837 aa AA seqDB search
MPDTDLLVPLLPCVRVPGLGDNVYKEECCFSFDTPKSDDGLYICLSTFLGFNRKYVELFH
ETTGHKLFLHMKQIKKILPKSEEASPVEKKKPKRLAIGIEGGFDAANGEKIEYEDVNELV
ILPEFKVIGLDNIEEIPSVVLASVSGILASTSASKKEEELSWDGEIRPVSKHAENLQQLD
NGVKIPPSGWKCCKCDLTSNLWLNLTDGKILCGRRYFDGTGGNNHAVDHFKETKYPLAVK
LGTITAFGADVHSYDEDTMVEDPHLAKHLSHFGINMMNMQKTEQTMTELEIELNEKVGNE
WDLIQESGKNLKQLQGPGLVGLNNMGNTCYMNSVIQVLYSIPEFMERYTTEDRCRDLFKR
KLSTLANLHSNGWSAAKASNEIQNRVLESSGDFSIQLCKLGLALTSPDMLKHQDSTKQEV
TSCSVTPRTMKRIVGRGHPEFSTNRQQDTHEFLLHVLSVIERSEHKNGSVSPGEVFRFMV
EDRIECQASKQVRYTKRSDYALALPIPLEAAANKAAVGEYQAVVEANKKDVSVKVGEVVR
LSIPYTACIEAFAHDELIQDFWSSAVKEKAEAKKRTRFVTFPDYLVVQMKKFTVGEDWVP
KKLDVSVEMPDILNLNDLRGGGLQKDETLLPDIEPPSAPPSEPLIEIDEEAVIAISQMGF
PLARCREALVATGNMGVEAAVMWLMENNTPEPAGAAAAQPSGASDGNVASIVAMGFTEGQ
AKKALHATGNNLERAADWIFSHLDELDSIEVDTPLEPANQVAAGDTPMDTSANHLKDGSG
NYELFAFISHMGSSTMCGHYVCHIKKDGRWVIFNDEKVAESEQPPKDLGYIYFYKRA
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatactgacttgttggtgccactgctgccttgtgtgagggttccagggttggga
gacaatgtttataaagaagaatgctgcttctcatttgatacaccgaaatctgatgatggt
ttatacatctgtttgagcacttttcttggtttcaatcgcaaatatgttgagttattccat
gaaactactggccataaactttttcttcacatgaagcaaataaaaaagattttgccaaag
tcagaagaagcatctccagtcgaaaaaaagaaaccaaaacgacttgctattggtatagaa
ggtggttttgatgcagctaatggtgaaaagattgaatatgaagatgtcaatgaacttgtt
attctacccgagtttaaagttattggtttagataacatagaggaaatcccatcagtggtg
cttgccagtgtcagtgggattcttgcttcaacttctgcatcgaaaaaagaagaagaatta
tcgtgggatggagaaataagacctgtgtcaaaacatgcagagaacctacaacaactcgat
aacggggtaaagattccccctagtggctggaaatgttgcaagtgtgatttaacatcgaac
ttgtggttgaatttaactgatggaaaaattttgtgcggtcgacgttactttgatggaaca
ggaggaaataatcacgctgtggatcatttcaaagaaactaaatatccacttgccgtgaag
cttgggaccatcactgcttttggtgcagacgttcactcatatgatgaagacaccatggta
gaagatcctcatcttgctaaacatctttcacattttggaatcaacatgatgaatatgcag
aagacagaacaaactatgacggaactagaaattgaattgaatgaaaaagttgggaacgaa
tgggatctcatacaagagtcaggaaaaaatctaaaacaactccaaggtcctggtttggta
ggtttgaacaacatggggaacacgtgttatatgaactctgttatacaagtcctatatagc
ataccagagtttatggagaggtataccacagaagataggtgcagagatttgttcaagaga
aagttgtcaacactggctaacctacattctaatggttggtctgctgcaaaggcttcaaat
gaaatccagaatcgagttttagaatcctcgggtgacttctcgatacaattatgcaaatta
ggtcttgcacttacttcaccagacatgttgaaacatcaagattcaacaaaacaggaagtg
acctcgtgctctgtgaccccacgaaccatgaaaaggattgtgggtaggggtcacccagag
ttttccaccaacagacagcaagatacgcatgagtttttacttcatgttctctcagtaatc
gagcgttccgaacataaaaacggatcagtttctccaggagaggtgttcaggtttatggtg
gaagacaggattgagtgtcaagcaagcaaacaggttcgttacaccaaacgtagcgattat
gctcttgctctaccaataccccttgaagctgctgctaataaagctgctgtaggtgaatac
caagcagtggttgaagcaaacaagaaagatgtttcagttaaagtgggcgaggtggttcgt
ctttctataccatacacagcttgcattgaagcgttcgcacacgatgaacttatccaagat
ttttggagctcagcagtaaaggaaaaagcagaagcaaagaaacgaactcgattcgtgacg
tttcctgattatctcgttgttcaaatgaagaagtttacagttggggaagattgggtgcca
aagaaattagatgtcagtgttgagatgccggacattttaaacttaaacgacctccgaggt
ggggggttgcagaaagacgagacgcttctccccgatattgagcccccttcagccccccct
agtgagccgttaatcgagattgacgaggaagccgtgatcgcgatcagccagatgggattt
cccctagcccgatgccgtgaggcgctggttgccacgggtaacatgggtgtggaagccgca
gttatgtggttgatggaaaacaatacgccagagccagcaggtgcagcagcagcacaacct
agtggagcaagtgacgggaacgtagcttcgattgttgcaatggggtttaccgaaggtcaa
gctaagaaggctcttcacgctacaggcaataaccttgaaagagcagctgattggatattt
tcacatctcgacgaattagattcaattgaggtggacactccccttgaaccagccaatcag
gtggcagctggtgacacacccatggatacaagcgccaaccatttaaaagatggttcagga
aattacgaattgtttgcatttattagtcatatgggaagttctaccatgtgtggacattat
gtgtgtcatattaaaaaggatgggaggtgggtgatatttaatgatgaaaaagtagctgaa
tcggagcaaccaccgaaagatcttgggtatatctatttctacaagcgagcgtga

DBGET integrated database retrieval system