KEGG   Ciona intestinalis (sea squirt): 100175118Help
Entry
100175118         CDS       T01056                                 

Definition
Na(+)/H(+) exchange regulatory cofactor NHE-RF1-like
Orthology
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
cin  Ciona intestinalis (sea squirt)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 296 aa AA seqDB search
MSVLHKPRLYHLEQGSNGYGFHLHGEKGKVGQKIRKVEPGSPAEVAGLRVGDCVVAVNGW
NVENESHQEIVARIKERAGETDLLVVDEEANQYFKQNSIDITEGLIGNEDTVQQEQIIKK
VDGPRPRLCKLTRSDQGFGFNLHSEKGKQGRFIRSVDEGGAADRAGLLAGDRIIEINGVN
MEYERHASLVAAIKESGTDVELLVVDDQTDRFFKLCDVTPSSVHVEGALPQPPTPVVTSQ
STPPPTTPLAPQPNGDSPADILNMDLTTLKSKARSSKKKAAPSSNWNNRQSIFNNL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttcttcacaagccgaggttgtatcatttagagcaaggatcgaacggatacggg
tttcatttgcatggggaaaaaggaaaagttggtcaaaaaatccgtaaagtagaacccggt
agcccagccgaagtagcggggttgcgtgtgggtgattgtgtcgttgccgtgaatgggtgg
aacgttgaaaacgaaagtcaccaagagatagttgcacgaataaaggaacgagcgggagaa
actgacttgttggtcgtcgatgaagaagcgaaccaatatttcaagcaaaacagcattgac
atcacggaaggtttgattggtaacgaagacaccgtgcaacaagaacaaattattaaaaag
gttgatggtcctcggcctcggttgtgtaaattgactcgatcggaccaggggttcgggttt
aatttgcacagcgagaagggaaagcaaggtcgtttcattcgctcggtggatgaagggggg
gcggcggatcgcgctgggttgcttgcgggggatcgaattattgagataaatggagtaaac
atggagtacgagcgacatgcatcattggttgcggcaatcaaggagtccggtaccgatgtt
gagctacttgtcgttgacgatcaaaccgaccgatttttcaagttatgtgatgtaacgcca
tcaagtgttcatgttgaaggtgcgttgccccaaccaccgacaccagttgtgacatcacaa
tccacgcctcctccgaccacgcccctcgcaccccaacctaacggggattcccctgctgat
atacttaacatggacttaactacattgaaaagcaaggctcggtcgagtaaaaagaaggca
gctccgtcaagtaattggaacaaccgacaatctatcttcaacaatctgtaa

DBGET integrated database retrieval system