KEGG   Ciona intestinalis (sea squirt): 100175205Help
Entry
100175205         CDS       T01056                                 

Definition
cyclin-dependent kinase D-3
Orthology
K02091  
cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100175205
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   100175205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 620 aa AA seqDB search
MTSEQSHDADEAPSARASQSSLHAEPTSSPWTNQRYHTLSEIGVGAYGVVFKAQDMQSDD
ENKFVAIKCVRVENSEQGMPLSTVREIALLRQLESCEHPNVVRLLDICAGHHSKRETQLM
LVFEYVDQDLDVFLKKCPDSGLEPEKVTDIMRQMLGGLDFLHSMRVVHRDMKPQNILITT
TGQVKIADFGLARIYSIDMALTEVVVTLWYRSPEVLLLDSYATPVDIWSAGCIFAELFNR
RPLFRGTGDVNQLKKIFDFIGRPSEAEWPLNVAVPIDSFPPQPPRPPQKFVPSITEDAAD
FLMKLLVFDPGKRLTAQSALQHKYVQKASTSNEPNFLSSAVNQAVMYGSTSQGGSSSSHR
RLPYTKQMTTLQNHVSRSYDERYDSSHRGVDCPDSSRRSRVTPAMENITTDDVKTPTNDD
QKQSLDDRLSGRRKDKSSSHSASPSQHHQDESEFLTPPSDLASSSSGFMTSSSSRSSSPS
ESGVPSFVTDSTQQSSTFEVETSLRRSVTPAERIDEVQLRPKKSTDIDDQSRMSWAFEPI
TDAESQLEIESQIQSKNQITQFKTPTKTPTYQMLESGKYVPYVTQKPHTEASHAICGHSS
QSSYSSSEGDSQASQPRPEK
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtgaacagagtcatgatgcagatgaagcaccaagtgctcgtgccagtcagtca
tccttacatgccgaacctaccagcagtccatggacaaaccagcgttaccatacactatct
gagattggtgttggtgcttatggtgttgtgtttaaggcacaagacatgcagagtgatgat
gagaataagtttgtggcaataaaatgtgttcgagtggaaaattctgagcaaggtatgcct
ttgagtacggtccgtgaaatagctttactgaggcagcttgagtcttgtgaacaccctaat
gttgtcagattacttgacatttgtgctggccaccattcaaaacgtgaaacacaactcatg
cttgtgtttgaatatgttgaccaggatcttgacgtgtttttaaaaaaatgccccgactct
ggattagaaccggaaaaagtcacagatattatgcggcaaatgttggggggtttggatttc
cttcattccatgagggtcgttcatcgagacatgaaaccacaaaatattctcatcaccaca
actggtcaagttaaaatcgcagattttggtcttgccagaatttacagcattgatatggca
ctaactgaagtggtagtaactttatggtatcggtcaccagaagttctactacttgacagt
tacgcaacaccagttgatatttggagcgctggttgtatctttgccgagttatttaataga
agacctttattccggggcaccggagatgtgaatcaactcaagaaaatattcgatttcatt
ggtcgaccaagtgaagcagaatggccacttaatgttgctgttccgattgattctttccct
ccccaaccacctagacctccacaaaagtttgttccttctatcactgaagatgctgctgac
tttttaatgaaactccttgtgtttgatcctggtaagagacttactgcacagagtgcattg
caacataaatatgttcagaaagcatcgacatcaaatgagcctaactttctatcaagtgca
gtgaatcaagctgttatgtatggtagcaccagccaagggggtagcagttcaagtcatcgg
agactgccgtacacaaagcaaatgacaacgttacaaaatcatgtttcacgatcatatgat
gagagatatgattcatcacatagaggagttgattgcccagacagctcacgaagatcacgc
gtcacgccagccatggaaaacataacaaccgatgacgtaaaaacaccaaccaatgacgac
cagaaacaatcacttgatgatcgtctttctgggagaagaaaagacaaatcatcctctcat
tctgcatcaccatctcaacaccatcaggatgaatcagaattcttaactcctccatcagat
cttgcatcttcatcatccggatttatgacttcttcttcatcaaggtcatcatccccatct
gaaagtggtgttccatcgttcgtaacagattcaacccaacaatcatcaacatttgaagtt
gaaacatcgttgcgtcggtcagtcacaccagcggaacgaatagacgaggtacaacttaga
cccaaaaaatcgacagacattgatgatcaaagtcgaatgtcatgggcgtttgagccgata
actgacgcagaaagtcagttggaaatagaatcacaaatacagtcgaaaaatcaaattaca
caatttaaaacgccaactaaaacacccacatatcaaatgcttgagtccggtaagtacgtg
ccgtatgtgacacaaaaaccacatactgaagccagccacgctatatgtggccattcatca
caaagctcatatagcagtagtgaaggagattcgcaagcatctcaaccaaggccagaaaag
taa

DBGET integrated database retrieval system