KEGG   Ciona intestinalis (sea squirt): 100175244Help
Entry
100175244         CDS       T01056                                 

Definition
glycerol kinase-like
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100175244
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     100175244
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100175244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 559 aa AA seqDB search
MDDLQYVGAVDQGTSSTRFLVFSAKTAELIAYHQVEVSQLFPNEGWVEEDPMEILNTVYE
CIDKTVQGLNRLNIPVSSIKAIGITNQRETTVVWDKYTGQPLHHAIVWCDNRTQSTVDKL
VSKTPNKSQDYLRQYCGLPISTYFSAVKLRWLLDNRPDVRRAVDEGRALFGTVDSWLLWN
MTGGAKSGGKHITDITNASRTMLCNIRTQKWDAELLEFFDIPASVLPEIRSSAEHYGDLT
EGSLKGIPLCGCLGDQHAALVGQTCFKSGDAKNTYGTGCFLLQNTGTKPVMSRHGLLTTV
GYKLGKNEPTIYALEGSVAVAGGLVRWLRDNLGIIKESSDIEELAKQVNGSGDVVFVPAF
SGLYAPHWRTDARGTVCGITQWTTKAHIAYATLEAVCYQTREIIEAMKQDALDADTEEHS
SSTLQVDGGMTNNNLLMQLQADILGCTVMKPSMPETTALGAAMAAGKACGIWNLNPDELT
NVTFEKFHPSVHEHEISKRYKLWKMGVEKSKGWHFGSGGNATSNAQVTDHNAEKGKSMFS
GTMFLISSFALLVLAQMSD
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggatgatctgcagtatgtcggtgctgttgatcaaggcacaagcagcacgagatttctg
gtattcagtgctaaaacagcggagctaatcgcgtaccaccaagttgaagttagccagcta
tttcccaatgaaggatgggtggaggaagatcctatggaaatattgaacacagtttatgaa
tgcattgataaaactgtacaaggtttaaatcgtttgaatattcctgtcagctcaatcaaa
gctattggaataaccaatcaacgagagacaaccgttgtgtgggacaaatacacagggcaa
ccgttacatcatgcaatagtttggtgtgataaccgcacgcaatccactgtggataaactc
gtttccaaaactccgaacaaaagccaagattatctcagacaatattgtgggcttcccatc
agcacatatttctcagcagttaagttgagatggttgcttgataatcgaccagatgtaagg
agagctgttgatgagggaagggcattgtttggaactgtagattcatggctactgtggaat
atgactggaggagcaaagagcggaggaaaacacatcactgacatcacaaatgcctctcgt
accatgctctgtaacatccggacacaaaagtgggatgcagagttactggaattctttgac
atccctgcttcagtgttgccagagattagaagtagtgctgaacattatggtgacttgacg
gagggttcattaaagggaataccactctgtgggtgcttaggtgaccagcatgcagcatta
gttggacaaacatgttttaaatccggtgatgctaaaaatacatacggtactggttgtttt
ttactgcagaatacgggaacaaaacctgttatgtcccggcatggcttgcttaccactgta
ggttataaactgggcaagaatgaaccaacaatttacgcattagagggatctgtagctgta
gcaggtgggttggtacgatggcttcgagacaacttgggaattattaaagaaagttctgat
attgaggagctggcaaagcaagtgaatggatccggtgatgttgttttcgttcctgcattc
tccggactttatgctcctcactggaggactgatgcaagaggaacagtatgtgggatcaca
caatggacgaccaaggcacatatcgcgtatgctactttggaggccgtttgttatcaaact
agagaaataattgaagcaatgaaacaagatgcacttgatgctgatactgaggaacattca
tcttcaacattacaagtagatggtggaatgacaaacaataatctactgatgcaactgcaa
gctgatatccttggctgtacagtcatgaaaccatccatgcctgaaacaacagcattagga
gcagccatggcagcaggaaaggcttgtggtatttggaatcttaaccctgatgaacttacc
aatgtaacttttgagaagttccaccccagtgtgcatgaacatgaaatttcaaaaagatat
aaattgtggaaaatgggtgttgagaaatccaagggctggcactttgggagtggtggcaat
gccaccagtaatgcacaagttaccgaccacaatgcagaaaaaggaaaatccatgttttct
ggcaccatgtttctaatatcatcatttgctttacttgtattggcccaaatgtcagactaa

DBGET integrated database retrieval system