KEGG   Ciona intestinalis (sea squirt): 100175244Help
Entry
100175244         CDS       T01056                                 

Definition
glycerol kinase-like
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cin00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 559 aa AA seqDB search
MDDLQYVGAVDQGTSSTRFLVFSAKTAELIAYHQVEVSQLFPNEGWVEEDPMEILNTVYE
CIDKTVQGLNRLNIPVSSIKAIGITNQRETTVVWDKYTGQPLHHAIVWCDNRTQSTVDKL
VSKTPNKSQDYLRQYCGLPISTYFSAVKLRWLLDNRPDVRRAVDEGRALFGTVDSWLLWN
MTGGAKSGGKHITDITNASRTMLCNIRTQKWDAELLEFFDIPASVLPEIRSSAEHYGDLT
EGSLKGIPLCGCLGDQHAALVGQTCFKSGDAKNTYGTGCFLLQNTGTKPVMSRHGLLTTV
GYKLGKNEPTIYALEGSVAVAGGLVRWLRDNLGIIKESSDIEELAKQVNGSGDVVFVPAF
SGLYAPHWRTDARGTVCGITQWTTKAHIAYATLEAVCYQTREIIEAMKQDALDADTEEHS
SSTLQVDGGMTNNNLLMQLQADILGCTVMKPSMPETTALGAAMAAGKACGIWNLNPDELT
NVTFEKFHPSVHEHEISKRYKLWKMGVEKSKGWHFGSGGNATSNAQVTDHNAEKGKSMFS
GTMFLISSFALLVLAQMSD
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggatgatctgcagtatgtcggtgctgttgatcaaggcacaagcagcacgagatttctg
gtattcagtgctaaaacagcggagctaatcgcgtaccaccaagttgaagttagccagcta
tttcccaatgaaggatgggtggaggaagatcctatggaaatattgaacacagtttatgaa
tgcattgataaaactgtacaaggtttaaatcgtttgaatattcctgtcagctcaatcaaa
gctattggaataaccaatcaacgagagacaaccgttgtgtgggacaaatacacagggcaa
ccgttacatcatgcaatagtttggtgtgataaccgcacgcaatccactgtggataaactc
gtttccaaaactccgaacaaaagccaagattatctcagacaatattgtgggcttcccatc
agcacatatttctcagcagttaagttgagatggttgcttgataatcgaccagatgtaagg
agagctgttgatgagggaagggcattgtttggaactgtagattcatggctactgtggaat
atgactggaggagcaaagagcggaggaaaacacatcactgacatcacaaatgcctctcgt
accatgctctgtaacatccggacacaaaagtgggatgcagagttactggaattctttgac
atccctgcttcagtgttgccagagattagaagtagtgctgaacattatggtgacttgacg
gagggttcattaaagggaataccactctgtgggtgcttaggtgaccagcatgcagcatta
gttggacaaacatgttttaaatccggtgatgctaaaaatacatacggtactggttgtttt
ttactgcagaatacgggaacaaaacctgttatgtcccggcatggcttgcttaccactgta
ggttataaactgggcaagaatgaaccaacaatttacgcattagagggatctgtagctgta
gcaggtgggttggtacgatggcttcgagacaacttgggaattattaaagaaagttctgat
attgaggagctggcaaagcaagtgaatggatccggtgatgttgttttcgttcctgcattc
tccggactttatgctcctcactggaggactgatgcaagaggaacagtatgtgggatcaca
caatggacgaccaaggcacatatcgcgtatgctactttggaggccgtttgttatcaaact
agagaaataattgaagcaatgaaacaagatgcacttgatgctgatactgaggaacattca
tcttcaacattacaagtagatggtggaatgacaaacaataatctactgatgcaactgcaa
gctgatatccttggctgtacagtcatgaaaccatccatgcctgaaacaacagcattagga
gcagccatggcagcaggaaaggcttgtggtatttggaatcttaaccctgatgaacttacc
aatgtaacttttgagaagttccaccccagtgtgcatgaacatgaaatttcaaaaagatat
aaattgtggaaaatgggtgttgagaaatccaagggctggcactttgggagtggtggcaat
gccaccagtaatgcacaagttaccgaccacaatgcagaaaaaggaaaatccatgttttct
ggcaccatgtttctaatatcatcatttgctttacttgtattggcccaaatgtcagactaa

DBGET integrated database retrieval system