KEGG   Ciona intestinalis (sea squirt): 100175296Help
Entry
100175296         CDS       T01056                                 

Definition
protein disulfide-isomerase A6-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cin04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 376 aa AA seqDB search
MNLPTICVFGPASIGAVNADAHPSLGSKYGVQGFPTIKIFGFDKSNPKPYNGARSADAIT
DAAMKAVREMVEDRKSGKKRGGGGGGQSRKEEKSSSDDVVTLTDSNFRELVLEGKETWFV
EFYAPWCGHCKNLAPQWARAATEVKDKTEGTIKLGALDATVHQATAQQYGIRGYPTIKIF
KQNEKSSPIDYDGSRDSSGIVNKAMEYYVENIDPPTIYELVSQEVFDENCGTHLCILAFL
PDIADDGKDGRNRYIDLLKSLGDRFKKQRWGWAWLPANANPELEKSLKVGGSGYPALVAL
NKKKDVYALYMGAFSDDGLGPFLNQLTYGRSRLSTHTLSEGKLPEVKTREPWDGKDAPPM
EFVDEDLSDFKWDDEL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaccaaccatatgcgtctttgggcctgcgagcattggtgcagtgaatgcagat
gcccacccctcattaggctctaaatacggtgtccaaggttttcctacaatcaaaatcttt
ggttttgacaaaagtaatccaaaaccttacaatggtgcaagatctgcagatgccatcact
gatgcagcaatgaaagcagttcgcgagatggtagaagatcgaaaaagtggaaaaaaacgt
ggaggtggtggtggtggacaaagtcgaaaagaggaaaaatcatcaagtgatgatgtcgtc
acgcttaccgattcaaactttagagaacttgtacttgaagggaaagaaacttggttcgtt
gaattctatgcaccgtggtgtggacattgtaaaaatcttgcaccacagtgggcgagagca
gcaactgaagtgaaagataagactgaaggaacgatcaaactcggtgcattagatgcaaca
gttcatcaagctactgctcagcaatacgggatccgtggttatccaaccattaaaattttt
aaacaaaatgagaagagcagcccaatagattacgatgggtcacgcgattcgagtggtatc
gtcaacaaagccatggaatattatgtggaaaatatcgacccaccaactatttatgaactt
gtaagtcaagaagtgtttgatgagaattgtggaacccatctttgtattcttgctttctta
cctgatattgccgatgatggtaaagatggtaggaacagatatatagatttgttgaaatca
cttggtgatcgattcaagaaacaaagatggggatgggcttggcttcctgctaatgcaaat
ccagaattggaaaaatcattgaaagttggtggatcaggttacccggctcttgtggcttta
aacaagaaaaaggatgtttatgcattatacatgggtgcatttagtgatgatggtcttggc
ccattcctcaaccaattgacttacggacgcagtcggctcagtactcacacactatctgaa
ggaaaactacctgaagtgaaaacccgtgaaccctgggatggaaaagatgcaccaccgatg
gaattcgtggatgaagacctcagtgattttaaatgggatgatgaattatga

DBGET integrated database retrieval system