KEGG   Ciona intestinalis (sea squirt): 100175390Help
Entry
100175390         CDS       T01056                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:cin01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cin00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cin00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 449 aa AA seqDB search
MSLYIRGTSKLLSQLRYSARKLSIPAASKVHTTQQLKSYTQLETWRAKDVKPQLTRQQRL
FHITATKFDAVTVNCPPFAESITSGDIVWEKAVGDSVEIDEMVAEIETDKTTIPIPAPSS
GVIEELLVEEGATVTPGTPLFKLNSDGASAAPQPAKEEAPAAAAPSSPTEPAPVSTPIPD
TLPPPPPVPSAPMASKKVSDVKITPSIAPVSVTGSRSEHRVKMNRMRQRISQRLKDSQNT
AAMLTTFNEVDMTNIMALRNKHKDAFLKKHGVKLSFMSAFIKASAYGLTDQPVVNAVIDD
ASNEIIYRDYVDISIAVSTEKGLVVPVLRNCENMNFLEIEQEMTSLAQKARENKLTVEDM
DGGTFTISNGGVFGSMFGTPIINPPQSAILGMHAILDRPVAINGEVKIRPMMYIALTYDH
RLIDGREAVTFLRKIKAGVEDPSIYLLGM
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgtacataagaggaacatctaaattactctcacaactaagatacagtgcacga
aagttatctattccagctgcctcaaaagtacacacaacccaacaacttaaatcttatact
caattagagacatggcgtgcaaaagacgtcaaacctcaactgacaaggcaacaacgcttg
tttcacattactgcaacaaaatttgatgctgtgacagtcaattgtcctccatttgctgaa
tctattacttcgggagatattgtttgggaaaaagcagttggtgattcagttgagattgac
gagatggtggctgagatagaaacagacaaaactacaatccctattcctgcaccttcatct
ggggttattgaagaactcctagttgaagagggtgctactgtcactcctggaacaccgctt
tttaagctcaatagtgatggagcatctgctgctccacagcctgccaaggaagaagcccca
gcagcagctgcaccatcctccccaacagaaccagcaccagtttcaactccaattcccgac
acccttccacccccaccacccgtgccctctgctccaatggcttccaagaaagtttctgat
gtcaaaattaccccatcaattgctccggtttcagttacaggatcgcgatctgagcaccga
gtgaagatgaacagaatgcggcaacggatctcacagcgactcaaggattcccaaaacaca
gcagccatgctcactactttcaatgaggttgacatgaccaacatcatggccctgagaaat
aagcacaaggatgctttcttaaagaaacatggcgtgaaattgagcttcatgtcagctttc
attaaagcttctgcatatggtctaacggaccagccagtggtgaatgcagtgattgatgat
gcttcaaatgagatcatttacagagattatgttgatattagcatcgcagtttccaccgaa
aaaggacttgttgttcctgtgttgagaaattgcgaaaatatgaatttccttgaaatagag
caagagatgaccagtcttgcacagaaggctagagagaacaagcttactgtagaagacatg
gatggtggcactttcacaattagtaatggtggagtttttggttcaatgttcggcacccct
attattaacccaccacaatcagccattcttggcatgcacgccatacttgatagaccggta
gcaatcaacggtgaggtaaagatccgccctatgatgtacatcgctctcacctatgaccac
agactgatagatggaagagaggcggtcactttcctccgcaagatcaaggcaggagtggag
gaccccagtatttatctccttggaatgtag

DBGET integrated database retrieval system