KEGG   Ciona intestinalis (sea squirt): 100175390Help
Entry
100175390         CDS       T01056                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100175390
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100175390
  Amino acid metabolism
   00310 Lysine degradation
    100175390
Enzymes [BR:cin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100175390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 449 aa AA seqDB search
MSLYIRGTSKLLSQLRYSARKLSIPAASKVHTTQQLKSYTQLETWRAKDVKPQLTRQQRL
FHITATKFDAVTVNCPPFAESITSGDIVWEKAVGDSVEIDEMVAEIETDKTTIPIPAPSS
GVIEELLVEEGATVTPGTPLFKLNSDGASAAPQPAKEEAPAAAAPSSPTEPAPVSTPIPD
TLPPPPPVPSAPMASKKVSDVKITPSIAPVSVTGSRSEHRVKMNRMRQRISQRLKDSQNT
AAMLTTFNEVDMTNIMALRNKHKDAFLKKHGVKLSFMSAFIKASAYGLTDQPVVNAVIDD
ASNEIIYRDYVDISIAVSTEKGLVVPVLRNCENMNFLEIEQEMTSLAQKARENKLTVEDM
DGGTFTISNGGVFGSMFGTPIINPPQSAILGMHAILDRPVAINGEVKIRPMMYIALTYDH
RLIDGREAVTFLRKIKAGVEDPSIYLLGM
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgtacataagaggaacatctaaattactctcacaactaagatacagtgcacga
aagttatctattccagctgcctcaaaagtacacacaacccaacaacttaaatcttatact
caattagagacatggcgtgcaaaagacgtcaaacctcaactgacaaggcaacaacgcttg
tttcacattactgcaacaaaatttgatgctgtgacagtcaattgtcctccatttgctgaa
tctattacttcgggagatattgtttgggaaaaagcagttggtgattcagttgagattgac
gagatggtggctgagatagaaacagacaaaactacaatccctattcctgcaccttcatct
ggggttattgaagaactcctagttgaagagggtgctactgtcactcctggaacaccgctt
tttaagctcaatagtgatggagcatctgctgctccacagcctgccaaggaagaagcccca
gcagcagctgcaccatcctccccaacagaaccagcaccagtttcaactccaattcccgac
acccttccacccccaccacccgtgccctctgctccaatggcttccaagaaagtttctgat
gtcaaaattaccccatcaattgctccggtttcagttacaggatcgcgatctgagcaccga
gtgaagatgaacagaatgcggcaacggatctcacagcgactcaaggattcccaaaacaca
gcagccatgctcactactttcaatgaggttgacatgaccaacatcatggccctgagaaat
aagcacaaggatgctttcttaaagaaacatggcgtgaaattgagcttcatgtcagctttc
attaaagcttctgcatatggtctaacggaccagccagtggtgaatgcagtgattgatgat
gcttcaaatgagatcatttacagagattatgttgatattagcatcgcagtttccaccgaa
aaaggacttgttgttcctgtgttgagaaattgcgaaaatatgaatttccttgaaatagag
caagagatgaccagtcttgcacagaaggctagagagaacaagcttactgtagaagacatg
gatggtggcactttcacaattagtaatggtggagtttttggttcaatgttcggcacccct
attattaacccaccacaatcagccattcttggcatgcacgccatacttgatagaccggta
gcaatcaacggtgaggtaaagatccgccctatgatgtacatcgctctcacctatgaccac
agactgatagatggaagagaggcggtcactttcctccgcaagatcaaggcaggagtggag
gaccccagtatttatctccttggaatgtag

DBGET integrated database retrieval system