KEGG   Ciona intestinalis (sea squirt): 100175461Help
Entry
100175461         CDS       T01056                                 

Gene name
mgam
Definition
(RefSeq) maltase-glucoamylase, intestinal
  KO
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100175461 (mgam)
   00500 Starch and sucrose metabolism
    100175461 (mgam)
Enzymes [BR:cin01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100175461 (mgam)
    3.2.1.20  alpha-glucosidase
     100175461 (mgam)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
7
AA seq 2734 aa AA seqDB search
MPTSNSGSNNVFEEIALDVDHSNDNDVTTRQTSVNDPQKGSITMVKVTGILMICAIIVLV
IILPVYFEVIVPNQNKGNAVVITTTTPVKPEPTETTPHTGDDEKNRFDCFPEGGATIETC
QQRGCIWLPPTVDTAAPSCFYSGKDGYSIIEVLEVTSTGLSQRIGKSKTAASPYGEEFDE
LLVTYTRVSNNKLRITIAPTSVKRFEIPWTHESASNTPVQDTLYDVQFTSTNGLFGIQVT
RKSTNAILFDTTVGRMMFSDQFLQISTKLASEYVYGFGEHMHESFKHDMSWKTYGMFSRD
QGVGPNANLYGVHPFHMCMEGDGNAHGILFLNSNAQDVTMQPTPALTYRSVGGIMDFYIF
VGPEPESVVSQYTETIGRPYMPPMWALGFQLCRYGYGSLDKLKKVVDRMLDSEIPYDVQY
TDIDYMDRQLDFTINATTYAGLEDFARDLKSTHKMKYIIIFDPAISGNETAGTYPPFDLG
KQQNVFIQNPDGEIAFGKVWPDLPGIYINTTWGWDDQTATFRAHAAFPDYFNPVTIQWWS
DLTVDFHKRLEFDGLWIDMNEPASFVHGSPNGCPDNKWDNPLPYHPAILGNDLFEKTTCM
SNLQYNPQTQELDVHYNMHSLYGWSQTKPTLDACRLSTGKRCMVISRSTFPGSGKYTGHW
LGDNTSLWSHLRASIIGMLEFNLFGIPYIGADICGFFQDTTEELCMRWMQLGAFYPFSRN
HNGLGSKDQDPAAFGPEFIAASKKVLEIRYSILPYFYTLFYDAHTTGSTVIRSLLAEFPT
DITTYTIETQFLLGGNILISPVLHEGEDSVKAYVPDATWYDYYTGAKLATGLRKTFTYFH
APWDYIPIHIKGGSIIPTQTPARTTELQRSNGLGIIYAIGDSLSQASGHLFWDDWDSIDD
FENGVYLMLRFSGDQESLSSMVEHNEYPDADSSIFDHITVMGVHGEQVSRVIVNGVRHSQ
FTFDGNTKMLQITGLNLQLTTEWTIVWDTNQYADRFNCHPESSIKATQLRCLNRGCLWHA
VSIPGVPPCYYPANYGAYKKDTAPMSTTAGEELYLERWNLPEFFERSVQRLKVEVEEHSE
YQLRIKISDANNPRYEVPMTLGGVNPTKPSEPLYEVIYQDQPFAFKVVRRSTREVIMDTN
VGGFIFEDQFIQISTKAATDYLYGLGEAEHANHKHDFYWTKETLHAKDEGVKQNANLYGY
HPFHLTMEKQGSAHGVLLLNSNAMEVELTPLPSITYRTIGGILDFYLFLGPTPNEVVQQY
SSAVGKPMQPPYWALGFQLCKYGYGNMNELRTVVDGMRNYQIPYDVQYGDIDYMDRQLDF
TIDPINYPNLPTFVNTMREDYKMRYVVILDPAISANETDPYPSYTDGMIADIFIRQNDGE
LAYGLVWPDVPGTLWEDSTLETRAHVLFPDFFNPTTKQWWTDNIARFYNEIKFDGLWIDM
NEPANFVNGSLGVGCPAANKYDHPPYLPGIIGDTLYTKTLCMSSKQYNPSTGTVDQLHYN
VHSMYGWSQAQPTKEACQAATGKRCYVISRSTYPGAGAHTGHWLGDNESKWSHMKASIIG
MFEFTLFGFSYTGADICGFFEDAEEEMCLRWSQLGAFYPFSRNHAMLGTKRQDPASWGAE
FAASVKKVLETRYTLLPYLYTLFYHSHTRGDSVVRPLMHEFPTDSNTWEIDTQFLWGPAL
LITPVLEQGKLTVDGYMADTRWFDYYSGAEVAQRKATVTLPAPMDHINLHVRGGYILPTQ
EPAVTTYYSRQNDFGLLVALDDNMKASGDLYWDDGESQNAVIDKFFTYSTITCEGNVLEN
RIITDGSSNMTLGSIVIMGLKDDVTQVFMRDQPLSKSQYTQDSTTKKLTILVKLSLHEEF
MVRWEVNNEWARIACMLDLQEGKVENRADCETRGCVWRLSTTPGVPSCFHDNTNNHGYTT
SQASSPAGLLIYDLVRKAKPTIYGGDVNNLKLNVEYQTDNRLHFKLTDPSSHRWEIPQAA
VNIPTTISSDATSSKVVVDVTNDPFSIKVTRKDNSEVIFDSSVGPLIYSDQFLQISTTLP
SLNVYGFGEHNHKRYRHDLNWRRWGIFTRDVAPVDDWNLYGHHTFYMALHKDGKAYGVYL
HNSNAMDILLQPTPAVTYRVTGGVLDFYLFVGDSPEALVQEYHKIIGFPILPPYWGLGFQ
LSRWNYGSLDRVKEVVQEMRDARIPFDIQYGDIDYMDAKKDFTYDPVKYAGLPAYVDQLH
DWGMRYVIILDPGIKIEPGYKAYDEGMQQDIFMKNPDGTSPVLTEVWPGDTYHPDFTHSA
ASQWWTDQCRDFHDNQGVHFDALWIDMNEPANFQTDDPTKRELMNCTGIYNFPPYLPRIL
GYWVGMYDKTFCMDNIQEWGLHYNVHSLYGHTMSQATYRTLEDLFPDKRSFTFSRSTFAG
SGKYSGHWLGDNQSLWPQMAWPIPGMFEFNLFGFPYIGADICGFWFNTTTEMCTRWTQVG
AFYPFSRNHNGAGMNPQHPTAFGTDFSDMARDVLQTRYQILPYMYTLFSNVHANGGTVVR
ALLHEFPSNPQTWNLDRMFLLGPAFLVTPVLDEGEVEVTGYFPQQSRWFDFRTGMEQVTG
KFLTLDAPMDYINLHVRGGYILPMQGPDVTTTLSRKKPMEILVALDDSQSAAGELYWDDG
EARNVGENFTRIEFKFGLNVLNFTVVHQAEYLPELDYLYIDKLTVYGLLSEPSTITCDGN
DEASFSWESVRNKLFLNLFSTLNLTDDHQCVFTF
NT seq 8205 nt NT seq  +upstreamnt  +downstreamnt
atgccgacttcaaacagcggctcgaataatgtgtttgaggagattgctcttgacgtggac
cactccaacgataatgatgtaaccacacgacaaacttcagtaaatgatccacaaaaagga
tcgatcactatggtgaaagtaactggaatcctaatgatttgcgccatcattgttcttgtg
attattcttcccgtatattttgaagtaattgttccaaaccaaaacaaaggcaatgctgtt
gtcattacaacaacaactcctgtaaaacccgaacccaccgaaacgacgccacacacaggc
gatgacgagaaaaaccgtttcgattgctttcctgagggtggtgcaaccatagaaacttgc
cagcaacgaggatgcatatggctacccccgactgtggacactgctgctccttcttgcttt
tactccggaaaagatggttattccatcatagaagtgcttgaggttacgagtacaggattg
tcgcaaagaatcgggaaatcgaaaacggcagcttcaccttatggggaggaattcgatgaa
ttattggttacttataccagagtttcaaacaataaactgcgtattacgattgcaccaact
tctgtaaagagatttgaaatcccatggacccacgaaagtgcttcaaacactccagtgcaa
gatactttatatgatgtacaatttacttcaacaaatggcttgtttgggatacaagttaca
agaaaaagcacaaatgcaattttatttgacaccactgttggtcgtatgatgttttctgac
caatttcttcaaatttccacaaaacttgcatctgagtatgtgtatggcttcggagagcat
atgcatgaatcgttcaagcatgacatgtcatggaaaacttacggaatgttttcgagagac
cagggtgttgggccgaatgcaaacttatatggagtccatcctttccatatgtgtatggag
ggagacgggaatgctcatggaatattatttcttaacagcaatgcacaagatgtgaccatg
cagcctacacctgcactaacatacagatctgttggtggtatcatggacttttatatcttt
gttggtcctgaacccgagtctgttgtctctcagtacactgaaactatcggcaggccatac
atgccacctatgtgggcgctaggattccagctgtgtagatatgggtatgggagcttggat
aaattgaaaaaggtggtggacagaatgctggattcagagataccttatgatgttcaatac
actgacattgactacatggatagacaactagattttacaatcaatgcaacaacatatgct
gggttggaagattttgcaagagatttaaaatccacacataaaatgaagtacattattatt
ttcgaccctgctattagtggtaacgaaactgctggcacttatccaccatttgatctggga
aagcaacagaatgtctttattcaaaatccagatggggaaattgcattcgggaaagtgtgg
cctgatttgccagggatttatattaatacaacttggggttgggatgatcaaactgctaca
ttccgagctcatgcagctttccctgactatttcaacccagttacaattcaatggtggtca
gatcttactgtggatttccataaaagacttgaatttgatgggctttggattgacatgaac
gagcctgcaagttttgttcacggttcaccgaacggttgccccgacaacaagtgggacaac
ccgttgccctaccatccagctatactgggaaacgacttgttcgaaaaaacgacctgcatg
tctaacttacaatacaacccacaaacccaggaattagatgtacattacaacatgcatagt
ttgtatggctggagtcaaaccaaacctaccctggatgcttgtaggttatcaactggtaaa
cggtgcatggtgatcagcagatcaacttttccaggcagtgggaaatacacagggcattgg
ttgggtgacaatacaagcttatggtctcatcttagagcttctataatagggatgcttgaa
ttcaacttgtttggaattccttatattggtgccgatatatgcggcttcttccaagacact
acagaagaactttgcatgcgatggatgcaacttggtgccttctatccatttagtagaaac
cataacggactcggatctaaagaccaagaccctgctgcttttgggccagagttcattgct
gcttctaagaaagtgcttgagatcagatattcaatacttccttacttttatactttgttt
tacgacgcacacactacaggaagcacagtcatcagatctttactagcggagtttccaaca
gacatcacgacttacacgattgaaacacaatttttacttggaggcaacattttaatatca
ccagttctacatgaaggggaagattcagtgaaagcttatgtacctgatgcaacgtggtat
gattactacacaggtgccaagttagcaactggattgaggaaaaccttcacttacttccat
gcaccatgggattatattcctattcacataaaaggtggaagcatcattcctacacagacc
ccagcacgtaccactgagttacaaagatctaacggacttgggattatttacgctattggt
gactctctatcacaagcaagtggccatttattttgggatgactgggattcaattgacgac
tttgaaaacggggtttacttgatgttaaggtttagtggagaccaggagagtttatcatcc
atggttgaacataatgaatacccagatgctgattcgtcaatatttgatcatataactgtg
atgggtgttcacggtgagcaagtatcacgcgtgatcgtgaatggagtcaggcactcacaa
tttacatttgatggcaacacaaagatgcttcaaatcactgggttgaacttacaacttaca
actgaatggacaatagtatgggataccaaccaatatgccgacaggttcaactgtcatcct
gaatcatcaatcaaagccacccaactacgttgtttaaatcgtggatgtctatggcatgca
gtatcaataccaggagttcccccatgttactaccctgctaactatggagcttataagaaa
gacacagctcctatgagcactacagctggtgaagagttatatcttgaacgttggaatctt
cctgagttttttgagaggtcagttcaaaggttaaaggtcgaagttgaagaacattccgaa
tatcaacttaggattaagataagtgacgctaacaatccaagatacgaggtaccgatgaca
ctagggggggtgaatcccaccaaaccgagcgaacctttgtacgaagttatttaccaagat
caaccattcgcatttaaagtagtgagaaggtcaacacgcgaagttataatggacacaaat
gttggtggatttatatttgaagatcaatttattcaaatatcaacaaaagctgccacagat
tacctttatggactcggtgaagcggaacatgcgaaccataaacatgatttctattggacc
aaggaaaccttacatgcaaaagatgaaggggttaagcaaaatgcaaatctttatggttac
caccctttccatcttaccatggaaaagcaaggcagtgcgcatggggttcttctgcttaac
agcaatgctatggaggtggagttgacacctttgccttcaattacttaccgtacaatcggt
ggaattttggacttttatcttttccttggaccaacacccaatgaagtggtgcaacaatat
agttcagctgttgggaaaccaatgcaacccccttactgggcacttgggttccaactatgt
aagtatggatatgggaacatgaatgaactgagaacagtggtggatgggatgaggaattac
caaataccatacgacgtgcaatatggtgatattgactacatggatagacaacttgacttc
actattgatccaatcaactatcctaatctacctacatttgttaacactatgagagaggat
tataaaatgagatatgtcgttatactggacccagctatcagtgcaaatgagaccgaccca
tacccctcatatacagatggtatgattgccgatatatttattcggcaaaatgatggggag
ctcgcttatggcctcgtgtggccggatgttcctgggactttgtgggaggattctactttg
gaaactcgtgcccatgttttgttccctgacttcttcaaccccaccactaaacaatggtgg
acagataatatcgctcgcttttataacgagatcaaatttgatggtttatggattgatatg
aatgaacctgctaactttgtcaatggtagtttgggagttggttgtccagctgcaaataaa
tatgatcatcctccttatttgcctggtatcattggggacactttgtacacaaagacactg
tgtatgtcatccaaacaatataacccaagtacaggtacagtggaccaacttcattataat
gtacatagtatgtatggatggtcacaagcacaaccaaccaaagaggcatgccaggcagct
actggtaaaagatgttatgtgataagtagatctacataccctggtgctggagcacataca
ggtcattggttgggagataatgaaagtaaatggtctcacatgaaagcttctatcattggc
atgtttgaatttactttgtttggcttctcatataccggagcggatatttgtggctttttc
gaagatgctgaagaagagatgtgtttaaggtggagtcagcttggtgcgttctatccattc
agtagaaatcatgccatgcttggtactaagagacaagacccagcatcttggggagcagag
tttgctgcttcagtgaagaaggttctagaaacaagatacacactactaccttacctttat
accttgttctatcatagccatactaggggtgactcggttgttaggcctcttatgcatgaa
ttccccactgattcaaatacatgggaaatagacactcagttcttatggggacctgccttg
ttaataacacctgtgttggaacaaggcaagttaactgtagatggttatatggctgataca
agatggtttgattattacagtggtgctgaagtagctcaacgtaaagccacagtcacatta
ccagcacctatggaccatattaacttacatgttagaggaggatatatacttcctacacaa
gaaccagctgttaccacttattatagccgacagaatgattttggattattggtagcgctt
gatgataatatgaaagcaagtggtgatttgtattgggatgatggggaatcacaaaatgct
gttatcgataaattcttcacatattctacgattacatgcgaagggaatgtgttagaaaat
cgaattatcactgatggcagttccaacatgacattaggctcaatagttattatgggttta
aaagatgatgtaacacaagtgtttatgagggatcagcctttgtccaagtcacaatacaca
caagatagcacaactaaaaagcttaccatattagtaaagttatccctccatgaagagttc
atggtaagatgggaagttaacaatgaatgggcacgtatcgcgtgtatgctggatcttcag
gaaggaaaagttgaaaatcgtgcggactgtgaaacaagaggttgtgtgtggaggctctct
accacacctggtgtcccatcttgtttccatgacaacacaaacaaccatggatatactact
tctcaagcaagtagtccagcagggcttctaatatatgacctggtaaggaaagccaaacca
accatatatggtggggatgtgaataatttaaaactcaatgtggaatatcaaactgataac
agacttcatttcaagcttactgatccaagttctcatcgatgggaaatcccccaagctgca
gtaaacataccaaccactattagttcagatgctacaagttctaaggtggttgttgatgtc
acaaatgatcctttctctattaaagttacaaggaaagataattctgaagttatatttgat
tcaagtgtgggacctctcatatactctgatcagtttctacaaatctcgacaactttacct
tctttgaatgtgtatggctttggagagcataatcataagagatacagacacgacttgaac
tggcgtcgttggggaatatttacacgagatgttgcaccagtagatgattggaacttgtat
ggccaccacaccttctatatggcactgcataaggatggcaaagcttatggggtttatcta
cataactctaatgccatggacattctccttcaaccaacacctgccgtcacatatcgtgtc
actggtggtgtgttggatttctatttgtttgttggagattctcctgaagcattggtgcaa
gagtatcacaaaataatcggctttcccatcttacccccttattggggccttgggttccaa
ttatcgcgatggaattacgggagtttagatcgggttaaagaagttgttcaagaaatgaga
gacgcacgaataccattcgatatacagtatggagacattgattacatggatgcgaaaaaa
gattttacgtatgatccagttaaatatgctggtctacctgcatatgtggatcaactgcat
gattggggcatgagatatgtcataatattggaccctgggattaaaatcgagcccggatac
aaagcttatgatgaaggaatgcagcaagatatcttcatgaaaaatcctgatggcacatca
cctgtgttaacagaggtttggccaggcgatacttatcaccctgacttcacccactctgct
gcctcccagtggtggacggatcagtgtcgggatttccatgacaaccaaggagttcatttt
gatgcattgtggattgatatgaatgaacctgccaactttcaaactgatgatccaaccaag
cgagaacttatgaactgcacaggaatatataactttccaccttatctaccacgtatcctt
ggttattgggttggtatgtatgataagacgttctgtatggataatatacaggagtgggga
cttcattataatgtacatagtttatatgggcacaccatgtcacaagctacatataggaca
ttggaggatttatttcctgacaaacgcagcttcactttctcacgttcaacattcgccggc
tcgggtaaatacagtggtcactggcttggtgacaaccagagtttgtggccacagatggct
tggccgatacctggaatgtttgagttcaatttgtttggattcccatatataggtgccgat
atttgtggcttctggttcaacacaaccactgagatgtgcacaagatggacgcaagttggt
gcgttctaccccttcagtagaaaccataacggggcaggaatgaacccacaacacccaaca
gcgtttggcaccgatttcagcgacatggctcgagatgtattacaaacaagatatcagata
ctaccatatatgtatacattgtttagtaatgtacatgctaatggaggaactgtggttaga
gctttattacatgaattcccatccaacccacaaacatggaacttggatcgaatgttttta
ctcggacctgccttcctcgttacaccagtgttagatgaaggtgaagttgaagtaactggg
tatttcccacaacaatcaagatggtttgattttagaacgggaatggagcaagtaactggg
aagttccttaccttggatgctcccatggattatatcaacctccatgtaagaggggggtac
atacttcctatgcagggacctgatgtcaccaccacattaagtcgtaagaagccaatggaa
atccttgttgcccttgacgacagccaatcagcagctggggaattatactgggatgatggg
gaggcaagaaatgtcggggagaattttacgagaattgaatttaaatttggattgaatgta
ctgaattttactgtggttcaccaagctgaatatctaccagagttggactatttatacatt
gataaactaaccgtgtatggattacttagtgaaccttcaacgataacatgcgatggcaac
gatgaagcttcattttcttgggaaagtgttagaaataagctttttttgaacctgttttcc
actcttaatttaacagatgatcatcagtgtgtttttactttttaa

DBGET integrated database retrieval system