KEGG   Ciona intestinalis (sea squirt): 100175675Help
Entry
100175675         CDS       T01056                                 

Gene name
gpx_e
Definition
glutathione peroxidase_like protein e
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100175675 (gpx_e)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100175675 (gpx_e)
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100175675 (gpx_e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 203 aa AA seqDB search
MLARSFLVKCTSSLMAGTAVVGFAKHIHTSQVLASSNTNWKDAASIYEFNALDITGNNVS
LDKYKGNVCIIVNVATQUGLTKSNYTQLQSLYEKYSKDGLRILAFPCNQFGNQEPKSNAE
ILKFAKDTFNVQFDMFAKIDVNGENAIPLYKYLKSGKNTGGFLTDAIKWNFTKFLVDKEG
KPVERYSPKDKPFDMESHIKSLL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgttggctagatcatttttagttaaatgcacatcatcgttaatggctggcacagctgtt
gttggatttgcaaaacacattcacacaagtcaagtattggcaagttcaaacacaaattgg
aaagatgctgcttctatttatgagtttaatgcattagacattaccggcaataatgtatca
ttggacaaatataaagggaacgtttgcattattgttaatgtagctactcaatgaggctta
actaaatcaaactatactcaactccaaagcttgtatgaaaagtactcaaaagatggcctg
cgaattttagcttttccctgtaatcagttcggtaatcaagagccaaaaagcaacgcagaa
attcttaaatttgctaaagacactttcaatgtacagttcgatatgtttgctaaaattgac
gtcaatggcgaaaatgcaattccactttataaatatcttaaatcagggaaaaatacagga
ggatttctgacggatgcgatcaaatggaatttcacaaagtttttggtcgacaaagaagga
aaacctgtggagagatacagtccaaaggacaagccatttgatatggagagccacattaaa
agcttattataa

DBGET integrated database retrieval system