KEGG   Ciona intestinalis (sea squirt): 100175976Help
Entry
100175976         CDS       T01056                                 

Definition
cAMP-dependent protein kinase catalytic subunit PRKX-like
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100175976
   04340 Hedgehog signaling pathway
    100175976
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100175976
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   100175976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 427 aa AA seqDB search
MSDSKTVSNSTNSNNVASVCDTTVDNLASSVSTVKLGNTNTSSTEHKLNSSPSTPKGENV
QNSNPAAGDTAATLNSVGNLNLPHVTQRGLEQGATGGGSRSPEYSVGRVERKLSLNDLEI
LSTIGTGTFGRVVLVKEKHTKEHFALKVMKICDIIKLKQVQHVKNEKSILNQIQHPFIVQ
LFWADHDNSFLYMLLEFACGGELFSYLRNAGRFNNSTSLFFASEIVSALEYLHQRHIVYR
DLKPENVLLDRDGHTKLTDFGFAKKVEDRTWTLCGTPEYLAPEVIQSKGHGRSVDWWALG
ILTYEMLAGFPPFWDESPFGIYQKILRGKVEFPKNMEGYAKDLIKKLLTADRTRRLGNMK
NASEDVKNHKWFRNIDWDAVVEKKMIPPIIPKVKHSGDTRNFEDYPEDNWQTTAAAQPKE
LSAFTDF
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagtgattccaagactgtgagcaattccaccaactcgaataacgtggcttcagtttgt
gatacaactgtggacaacctggcatcctctgtttccactgtgaagttaggaaatacaaac
acatcatctacagaacataaacttaacagttcaccatcaaccccaaaaggagaaaatgtc
cagaattcaaatccagcagcaggggacacggcggcaactttaaactctgttggcaattta
aatctcccccatgttacacaacgtgggttagaacaaggtgctacgggtggagggtcgcgg
tcacctgaatattcagtgggaagagtggaaaggaagctttcactcaatgacttggaaatt
ctatctacaataggtacaggtacgtttggccgtgttgttctggtgaaagagaagcacacc
aaagaacattttgcactgaaagtaatgaagatatgcgacatcattaaactaaaacaagtc
cagcatgtgaaaaatgaaaaatcaattttaaatcaaattcagcacccttttattgttcaa
ttgttttgggcggatcacgacaattccttcttgtacatgttgcttgagtttgcttgtggt
ggggaactattttcctacttaagaaatgcaggtcgttttaacaattccacctcattgttc
tttgcctctgagattgtgtcagcattagaatacttgcatcaacgtcacattgtttaccgg
gatcttaaaccagagaatgttttgcttgatagagatggacataccaagctaactgatttt
ggatttgccaaaaaagtagaagaccggacatggactctctgtggcacgcctgagtacttg
gctcctgaagtaattcaaagtaaaggccatggaaggtctgtggattggtgggcgcttgga
attttaacttacgagatgcttgctggttttccacctttctgggatgaaagtccgtttgga
atttaccaaaaaattctccgtggaaaagttgagtttccaaagaacatggaaggttatgct
aaggatttaataaaaaagttgctgactgctgatcgcacacgtcgtctcggtaacatgaag
aatgcatcggaagacgtgaagaatcataagtggttccgtaatattgattgggatgctgtt
gtagaaaagaaaatgattccacccatcattcctaaagtgaaacatagtggagatactcgc
aactttgaagattaccctgaagataactggcagacaacagctgcagctcaaccaaaggag
ttgagcgccttcactgacttctaa

DBGET integrated database retrieval system