KEGG   Ciona intestinalis (sea squirt): 100176030Help
Entry
100176030         CDS       T01056                                 

Definition
regulatory-associated protein of mTOR-like
Orthology
K07204  
regulatory associated protein of mTOR
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100176030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1289 aa AA seqDB search
MAGPDADEGKHEENKLDEEMKELMQLPLAYTEKRHHDKIAKPQTVSQAWRMKERMKTVSV
ALVLCLNVGVDPPDVVKTTPCARKECWIDPLSNSPQKALENIGNTLQKQYERWQPRARYK
QSLDPTVEDVKRLCTSLRRNAKEERVLFHYNGHGVPKPTANGEIWVFNKTYTQYIPLSIF
DLQTWMGSPSIFVYDCSSAGLIVNSFKSFAEQREQEQRVSCVNVLHSPTNTCNPKNCIQL
AACSSNQLLPMNPELPADLFTSCLSTPIKTALQWFCHQRQGTLSPGITLDLIEKIPGRLN
DRRTPLGELNWVFTAITDTIAWNILPRELFQKLFRQDLLVASLFRNFLLAERIMRSYRCT
PVSDPPLPPTFRHPMWGAWDHAVDVCLSQLPQMLNEETKYVFKNSPFFAEQLTAFQVWLT
LGIENRQPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQ
SLAKELRPLLVFIWAKILAVDGTCQSDLVKDGGHQYFLRALQDPMMSASHRTMAAFVLAE
IVNHNRAGQEVCLQRNIVSISLDQLDNDIIVSTPRLKQWVAICLGRIWTNYDDARWRGVL
DQAHVKLYELLDHPHPEVRASAIYSLGTFVDNQPEYGSDHAAHINQAVGATLAPLVKREA
SVLVRCELATALQRLVSCYDSSFAAIAFRFVEEEKDLDAQSTPSGKNKPRLSSSSQRIRS
IDYGNSPANFPTAKQVAGSGDTSFNESTNQKEEQNLTVERLNRLRRISLSSMPFSSGSSY
SSVNAHIWKVLLWLATDPHPLVSRLATTVVAGVMDRVDLMAREQHSRYLQTPDVSSAPNS
PRSRRKYSENVSENSAVVGSPSMIPIQLPPYPTIRKVFDKGPDQPTREIFRAGEIPSTMI
TLQDRSISTEFCGWSSHAFAQPCNKENNEEVLEEEEREKRRRKLEKKVKIKKRIETAHSN
FDTSRLGDQQFFNKNHRKAVDLTFHPYNNDLFVADAHGVSVWSWEKGQRKFYLQNTNPPQ
TTISSVQLINQHDSALLVVASDDGCLRVWQNCCGESIIEPTLVSAWKAMSDNIPSSRRAG
LVTHWDQRTLRIYTGGDSRNIQVWDTITERKEKEFQTGADSSVTCMTLGHGLLTTGFGDG
TVRLFDTRGRQSGFSTHAIHSHDTWVISTTFLPSTNMILTASEEGDIKLWDFRMLTSDPL
RTMRNTSAVRQLDVHPNLSIIACGSADHSINFMNLDGVDLGSVKYYEGFLGQRLGLASCM
RFHPLLANLAVGTADSYLTVYSGELKGQF
NT seq 3870 nt NT seq  +upstreamnt  +downstreamnt
atggctggacccgatgccgatgaaggcaaacatgaggaaaataaactggacgaagaaatg
aaagaattaatgcaactgccgttggcttacacagagaaacgacaccatgataaaatagca
aaaccacaaacagtttcacaagcatggagaatgaaagaacgcatgaaaacggtgagcgta
gcgctggtattatgtttgaacgtgggcgtggatcctcccgatgttgtgaagacgacgcct
tgcgcgaggaaagaatgttggattgacccgctaagcaacagtccacagaaagctttggaa
aacatcgggaatactttgcagaagcaatatgaacgttggcaacctcgggctcggtacaaa
caaagtttagaccccacagttgaagatgtaaagagattgtgcacctcgctacgaaggaat
gcaaaggaagaaagagttttgtttcattataacgggcatggggtgcctaaaccaacagct
aacggggaaatatgggttttcaacaagacgtacacccaatatatcccattgtcaatattt
gaccttcaaacttggatggggagtccctcaatattcgtgtacgattgttcatcagcgggg
ttgatcgtgaattcgtttaaatcgttcgctgaacaacgagaacaagaacagcgggtaagt
tgcgtgaacgtgttacactcccccactaacacatgcaaccctaagaattgcattcaactt
gccgcgtgttcatccaaccaactactgcccatgaaccctgaactcccggccgatcttttc
acctcgtgcctgtcaactcccatcaagactgctcttcagtggttttgtcatcaacgacaa
gggacgttatctcccgggatcacactcgatcttattgagaagatccccggtcggttgaat
gacagacgaaccccacttggtgaattgaattgggttttcacggcgataactgacacaata
gcgtggaatattctaccaagagaattattccaaaaacttttccgtcaagaccttctagtg
gcgagtttgttccgtaacttcctcctcgctgagcgtatcatgcgatcgtaccgatgtacc
cccgtatcggacccaccattaccccccaccttccgacacccgatgtggggggcatgggac
cacgccgtcgatgtttgtttatcacaactaccacagatgttgaacgaggaaacaaaatat
gtttttaaaaacagcccgttcttcgctgagcaattaacggcgttccaagtttggttgacg
cttggcatcgagaaccgacaaccccccgaacaattacctattgttctgcaggtacttctg
agccaggtgcatcggttacgagcccttgacctcctcggacgtttcctcgaccttggtcca
tgggccgtcagtcttgcgctgtccgtcgggatcttcccgtacgtcctcaaacttctacaa
agcctcgcgaaggaactacgaccgttgttggtgttcatatgggccaagatactggctgtg
gatggtacctgccaaagtgacttggtaaaagatgggggtcaccaatatttcctacgagcg
ttacaagaccccatgatgtctgcgtcacatcgtacgatggctgcgttcgtactcgctgag
atcgttaaccataatcgggcggggcaggaggtgtgtctacaacgtaacatcgtctcaata
tccctcgatcaactcgacaacgacattattgtttcaacgccgagacttaaacaatgggtg
gctatttgtttgggtcgtatctggacaaattatgacgacgctcgatggcgaggggtttta
gatcaagcgcacgtgaagttgtacgagttgctcgatcatcctcaccctgaggtccgcgca
tcagcgatttacagtcttggtacgtttgttgacaaccaaccagagtacggcagcgaccac
gccgctcacataaatcaagctgttggtgccactctagctcctctagtgaaacgggaggcg
agcgtcctcgttcgttgtgagctcgctacagccctccagcggttagtatcgtgctacgac
agcagttttgcagcgattgcgttccgcttcgttgaggaggagaaggatctcgacgctcaa
tcgacaccgagtggaaagaacaagccacgcctcagtagttcctctcaacgaatcagaagc
atcgattatgggaattcccccgctaactttcccaccgctaaacaagtagcaggaagtggc
gacacgagtttcaacgaatcgaccaatcagaaggaagaacaaaacttaacggttgaacga
ctcaacagattacgtcggatatcgttgtcatcgatgcctttcagctcaggttcatcatat
agttccgtgaacgcccatatatggaaagtattattatggttggctaccgacccccaccca
ttggtatcgaggttggcgacgactgtcgttgccggggtgatggatcgcgttgatttaatg
gcacgcgaacaacattctcgatatttacaaacccccgatgtttcgtccgcccccaactca
ccgaggtcgaggaggaagtactcggagaatgtttctgaaaattcagcggtggtgggttcg
ccatctatgatcccaattcaacttcccccgtacccaactatacgcaaagtattcgacaaa
ggaccagaccaaccaaccagggagatattccgagcgggggaaatcccaagcaccatgata
actttacaagatcgaagtatttcgaccgagttttgtggatggagctcccatgcgttcgct
caaccatgtaataaggaaaacaatgaagaggttctggaggaggaggaaagagaaaagaga
aggagaaagttggagaagaaggtaaagataaagaagagaatagaaactgctcattccaac
tttgatacttcacgcttgggcgaccaacagttcttcaacaagaatcatcggaaagccgtt
gatttgacctttcacccctataacaacgaccttttcgtggcggatgcgcatggggtcagt
gtatggagctgggagaagggccagcgtaagttctatctccaaaacaccaaccccccccaa
actacaatatcatccgtacaacttatcaaccaacacgacagcgcgctgctggtggtcgct
tcagatgatggatgtctaagggtctggcagaattgttgcggggaatccattattgagccc
acactggtatcagcttggaaagcaatgtccgacaacatcccgtcgtcgcgtagagcgggg
ttagtcacccattgggaccaacgcacccttcgtatttatacggggggtgactctcgtaat
atacaagtgtgggacacgataacagagagaaaggaaaaggagttccagacgggcgccgac
agctcggtgacgtgcatgacgctcgggcatgggttgttaacgacggggttcggtgacggg
acggttcgtttgtttgacacaagagggcgacaaagtggattctccacacatgcaatccac
tcgcatgacacgtgggtgatctcaacaactttccttccgtcgaccaacatgattttaact
gcaagtgaggaaggcgacatcaaactatgggacttccggatgttgacgtccgatcccctt
cgtacgatgaggaacacgagcgctgtacgtcaacttgacgttcatcctaacctgtcaatc
atagcttgcggatcagccgaccattcaatcaacttcatgaaccttgacggggtcgacctt
gggtcggtgaaatattacgaggggttcctgggtcagaggttgggtttggcatcgtgcatg
aggttccaccccttactggcgaacctcgctgtgggaacggctgattcataccttaccgtc
tactctggtgagctcaaaggtcaattctga

DBGET integrated database retrieval system