KEGG   Ciona intestinalis (sea squirt): 100176273Help
Entry
100176273         CDS       T01056                                 

Definition
calcineurin subunit B-like
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100176273
Protein phosphatases and associated proteins [BR:cin01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100176273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 180 aa AA seqDB search
MGQGVSYFTKDEQNEILEQTKLSPRYLQEVQKRYSQYDTSKSKDETSGVTIEQVLLIPEV
NQHKLAPIFAEKYGGRSGILYPKEFVNFFAAFSSARTPSEKVELLFEILDVRKLGYLQGI
EMYRYYHILLSPSLSDSQIENVAKKALNLTGGKIDLDKFKQIVQPWEVAEKMTIVLQLTD
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgggacaaggagtttcctattttacaaaagacgaacaaaatgagatattagaacaaacc
aagctttcgccaagatacttacaagaggtgcaaaaacgctattcgcaatatgacacatca
aaatcaaaagatgaaacatcgggtgtcaccattgagcaagttcttcttatcccagaagta
aatcagcacaaacttgcgcccatttttgctgaaaaatatgggggccgatccggtattctg
tatcccaaagaatttgtaaatttttttgctgcgttttcttctgcaaggacaccatctgaa
aaagttgaattattattcgaaatactggatgtcagaaaacttggttacctacaaggaatt
gagatgtatagatattaccatatcttgctctctccatcactaagcgattctcaaatcgaa
aatgtggcgaaaaaggcgttgaatctaactggaggaaaaatagacttggataaatttaaa
caaattgtccaaccatgggaagtagctgaaaaaatgacaattgttttacaattaaccgat
taa

DBGET integrated database retrieval system