KEGG   Ciona intestinalis (sea squirt): 100176359Help
Entry
100176359         CDS       T01056                                 

Definition
phosphoglycerate mutase 1-like
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100176359
   01230 Biosynthesis of amino acids
    100176359
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100176359
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100176359
Enzymes [BR:cin01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100176359
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100176359
  Exosomal proteins of melanoma cells
   100176359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 253 aa AA seqDB search
MTEYTVVMVRHGESEWNKANKFCGWFNADLSPKGKEEANAAGKALKDSGYSFDLAYTSVL
TRANETLDAILGELGQKSIPIKKSWRLNERHYGGLTGLNKAETAKKYGDAQVLTWRRSFD
VPPPQMGSDHEYYDIINKDERYKDVSSEDMPSCESLELTIKRALPYWSEEIVPNIKAGKK
IIIAAHGNSLRGIVKYLDEISDKDIMELNLPTGIPFYYKLDENMKPIVSMQFLGDAETVA
KAMAAVAAQGKSK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatatactgtagtaatggttcgtcatggagaaagcgaatggaacaaggcaaat
aagttctgcggttggttcaacgctgatttaagtccaaagggaaaagaagaggccaatgct
gctggtaaagctttgaaagacagtgggtattcatttgatcttgcttatacctctgtacta
actcgagccaatgagacacttgatgctattttgggcgaattgggccagaagagcattccg
attaagaaaagctggaggttaaatgaaagacattatggtggtttaactgggttgaacaaa
gctgaaacggctaaaaagtatggagacgctcaggttctgacttggcgcagaagttttgac
gttccccctcctcaaatggggagtgaccatgagtattatgacatcataaacaaagatgag
aggtacaaagatgtcagttcagaagatatgccaagttgtgaaagtttggaacttactata
aaaagagcattgccatactggagtgaggaaattgtaccaaatatcaaagcaggaaagaag
attattatcgcagctcatggaaatagtcttcgagggattgttaaatatttagatgaaata
tcagacaaagatatcatggaactgaatttgccaactggaattccattttattataagctg
gatgaaaacatgaaacccattgtgtctatgcagtttcttggagatgcagaaaccgttgca
aaagctatggcagcagtagctgcacaaggaaaatcaaaatag

DBGET integrated database retrieval system