KEGG   Ciona intestinalis (sea squirt): 100176396Help
Entry
100176396         CDS       T01056                                 

Definition
D-beta-hydroxybutyrate dehydrogenase, mitochondrial-like
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100176396
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    100176396
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     100176396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 389 aa AA seqDB search
MVYVVHLTDEVTKSFLSQKRATYRNMFTGELGRSVFGATVFTFVFALGVPWIGSTIFYIL
GLNYGCCTSTIAFFATCFLALLIFAVFPRGRLNPKDKAVLITGCDSGFGPLLAKQLHALG
MHVFAGCLLKDKGGEGAKHLMKIQSSRFHVLQLDVTNDSEIKMAVQYIGMHIPPNQDGLW
GIVNNAGASAFGEIEWSSIDLYKKVAEVNLWGVIRCTQACLPLIRRAKGRVVNMASGFGR
MIAGSRSVYGITKWAVEGFSDCLRYEMRRWGVKVSIIEPGNYIAGTSIFTEDGVKKLGDS
MWEKMPDNVKEDYGKKLFDLRVAEMQTYCSKGMDDLRPVLNAYEDALLSRIPLIRYQPME
AYWTIRSFVFTHFPSFIADYLYIYRKAKK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggtatacgtggtgcatttaactgatgaagtaacaaaatcgtttttatcgcagaaaagg
gcaacatatagaaacatgtttaccggcgaactcggaagaagtgtcttcggagccaccgtt
ttcacttttgtattcgcgctgggagttccgtggattggatcaacaatattttacattctt
ggcttaaactatggttgctgcacatcaaccattgcattttttgcaacatgttttcttgca
ttgttaatattcgctgtattccctcgaggaaggttaaatccaaaagacaaagcggttttg
ataacaggttgtgactcgggatttggtcccttattggcaaagcaactacatgcccttgga
atgcatgtgttcgcaggttgtttgttgaaagacaaaggtggtgaaggtgcgaagcattta
atgaaaatccagtcttctcgatttcatgtcctgcaacttgatgttactaatgacagtgaa
atcaaaatggccgtgcagtatattggaatgcatattccacctaatcaagatggcttatgg
ggaattgtgaacaatgctggagcatcagcgtttggagagattgagtggtcatctatagac
ttgtacaagaaggtggctgaggtcaacttatggggagtaattagatgcacacaagcatgt
ttaccactgattagaagagcgaagggtagagtggtgaacatggcaagtggttttggccga
atgatcgcaggatctcgctctgtttatggaatcaccaagtgggctgtagaaggtttctct
gattgcttgcgttatgaaatgaggagatggggtgtgaaggtatctattattgaacctggc
aactatatagctggaaccagcatctttactgaagatggagtgaaaaagttgggagattca
atgtgggagaagatgcctgacaatgtgaaagaggattatgggaaaaagttgtttgatttg
cgggtagcagaaatgcagacttattgcagtaaaggaatggatgatctcaggccagtgtta
aatgcatatgaagatgctttactttctcgtattccattgataagatatcaaccaatggaa
gcttattggacaattcgttcctttgtgtttacccactttccttctttcatcgctgactac
ttgtacatatatcggaaagcaaagaagtga

DBGET integrated database retrieval system