KEGG   Ciona intestinalis (sea squirt): 100176452Help
Entry
100176452         CDS       T01056                                 

Gene name
kat2a
Definition
(RefSeq) histone acetyltransferase KAT2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100176452 (kat2a)
Enzymes [BR:cin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100176452 (kat2a)
Transcription machinery [BR:cin03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100176452 (kat2a)
Chromosome [BR:cin03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100176452 (kat2a)
   HAT complexes
    PCAF complex
     100176452 (kat2a)
    STAGA complex
     100176452 (kat2a)
    TFTC complex
     100176452 (kat2a)
    SAGA complex
     100176452 (kat2a)
    SLIK complex
     100176452 (kat2a)
    ADA-HAT complex
     100176452 (kat2a)
    HAT-A2 complex
     100176452 (kat2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 718 aa AA seqDB search
MSEASPRRPVSEGKGVKTSEISKPFIPSELARPSNLQKIQQRKLQVKNYPRIKKLEKIGV
YSSCKDDNCKCNGWKNAQSTSNSGENQTSSQQLTTTVTLQDPCRACNHPLSTHVKHLDAA
KDDEINRLLSMIVDVENLVVCVQKEEDTDTKQVYFYLYRLLRKCTLQTSRPVIEGPLGSP
PFSQPSIGKAVTNFIIYKFGHLPQKEFQIMHELAKTFIYCLNQETLETPSTRTSRGQADD
FNEYKMNYTRWLCYCRVPKFCESLVHHATVDVFGRPLLKSIFPLLRRRILDDFRSDKFHV
PPDKRTLILSHFPKFLSMLEEELNASNSPIWDVDFSQMPAHMPLPSPRSNDSLNDMFITS
PGTPGSFPSLFSMTSPMGSLQTPIAVTPSGKRRADSGTQSSDDAKRARSSMQSDNDNTQQ
DFSLEVINEVVNMITDPAQMLGPEAANLSSQSARDEAARQEERQGLIEFHVVANCANASR
QILTWLVEIQNVFARQLPRMPRDYIARLVFDTRHRTLALVKEGRVIGGICFRMFPSQRFT
EIVFCAVTSNEQVKGYGTHLMNHLKEYHIKQSMYHFLTYADEYAIGYFKKQGFSKEIKVP
RSGYVGYIKDYEGATLMGCELNPRIPYTEFSNIIRKQKEIVKKLIEKKQQQISQVMPGLT
CFKDGVRQIPIESIPGIMNTGWKPNSDGKRKEIVESVESLFAPLKAIVQSMRVCMMYT
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagcatcaccaaggcgacctgtaagtgaaggaaaaggtgttaaaacctcagaa
atctcgaaaccatttattccgagtgagttagcacgtccgtctaacctacaaaaaatacag
caacgaaaacttcaagtaaaaaattacccacgtattaagaagttggaaaaaatcggagtc
tattcatcttgcaaggatgataattgcaaatgtaatggttggaaaaatgcacaatcaacg
tcaaattctggtgagaaccaaacaagtagccaacaattaacgaccactgtaacactacaa
gacccatgtcgtgcatgtaatcatccactttctacacatgttaagcatttagatgcagct
aaggatgatgaaatcaacagattgcttagcatgattgttgatgttgaaaatcttgttgtt
tgtgttcaaaaagaagaagataccgatacaaaacaagtttatttttatttatatcggctt
ctacgaaaatgtactctgcaaactagccgaccagtaattgaaggtccacttggttcacct
ccattcagccaacctagtattgggaaagctgttaccaactttattatttacaagtttggc
catttgccacaaaaggagtttcagatcatgcatgagttagcaaagacatttatttactgt
ttgaatcaagaaacccttgaaactccatcaacaagaacctcacgtggccaagctgatgat
tttaatgaatataagatgaattatacgagatggctatgttactgtcgtgtaccaaagttt
tgtgaaagtctcgtccaccatgctacagttgatgtatttggtcgtcctcttcttaaatcc
atcttccccctcctccgacgacgaattcttgatgatttccgatccgacaagttccatgta
cctccagataaaagaactttgattttgtcacactttcctaaattcctatctatgcttgaa
gaagaattgaacgcaagtaattcaccaatatgggatgttgacttttcacagatgcccgct
catatgccactaccttcacctagatctaatgattcattaaatgatatgtttattacaagt
cccggcacacctggtagttttccaagtttgttttccatgacatcaccaatgggaagtctt
caaacaccaattgctgttacaccaagtgggaagcgtcgagctgacagtggtactcagtcc
tccgatgacgccaagcgtgctcgctcatccatgcaatctgacaacgataacacacaacaa
gatttttcactggaagttattaatgaggtggtcaatatgataactgatcctgctcaaatg
ttgggtcctgaggcggctaacctgtcatcacaatcagctagagatgaagctgcacgacag
gaagaaaggcaaggtctcattgagtttcatgtcgtagctaactgtgccaatgcctcccgt
caaatcctcacatggctggttgagatacagaatgtattcgcacgtcagctgccaaggatg
ccacgagattacattgctcgtttggtgtttgatacaaggcataggactttagctttagtg
aaagagggtcgcgttattggtggaatttgttttcgaatgttcccatcgcaaaggttcacg
gagattgtattctgtgctgtgacatccaatgaacaggttaaagggtatggaacgcatctt
atgaaccatttaaaggaatatcacattaaacagagtatgtaccacttcctcacctatgct
gatgaatacgctatcggttactttaagaagcagggtttcagcaaagagataaaagtccca
cgatctggatatgtggggtacattaaagattacgaaggtgccactctaatgggatgtgaa
ttaaacccaaggattccttacactgagtttagtaatataataagaaagcaaaaagaaatt
gtaaagaaactgattgagaaaaagcagcaacagatcagccaagttatgcccggtctaact
tgctttaaagatggggttcgtcagatacctatagaaagcatacctggcataatgaacact
ggatggaaaccaaatagcgacggcaaacgaaaagaaatcgtggaatctgttgaaagtttg
tttgcacctctgaaagctatagtgcaaagcatgagggtatgtatgatgtatacttaa

DBGET integrated database retrieval system