KEGG   Ciona intestinalis (sea squirt): 100176680Help
Entry
100176680         CDS       T01056                                 

Definition
dopamine beta-hydroxylase-like
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100176680
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     100176680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 443 aa AA seqDB search
MTIEVRNIMLGGSYSFGFGFSDDENMGDGDLIVVRVTRTSVAIKDCWLYTNGKVVEDSKH
SYKLLGYQYSNGVWNIKVERKFQTCDGEDYQLDNGTTNVFVVFPIPNNCILSINGNGCNL
SEATKTLTRVQLLKADYRDIPLEPNHKSFSIIAPNITIPTSQTSYVCSIQKLPKFRTKVH
AIGFESVIANPGLVHHIEVFIHVVAAWAFGADPFYYPREAGMAFGVKTASSYVRLEVHYN
NPMHIRGLVDGSGIRFHFTENLRPHDLGIMEVGVIYSANMAIPPGQKSFKWSGECPGSCT
QAGDSLITTCTFNTENRSNITLGGLGLHEEMCVDYIYYYPATNLEVCKSSISSQALEMYF
KLIKLSLGIPRPRNSRPLHHEYDVIKWGNSAVRSLRQLYRFAPMQVNCLRSNGESYPGRW
DNITPATHFPRAMEPQCYANNKP
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgactattgaagtgagaaacattatgttggggggttcatattcgtttgggtttggtttc
tctgatgacgagaatatgggagatggtgacctcattgttgttcgtgtaacaagaaccagc
gtggcgattaaagattgttggctttatactaatggtaaggtcgttgaagattcgaaacat
agctacaagttacttggataccaatatagtaatggcgtttggaacatcaaggttgaaaga
aagtttcaaacatgcgatggagaagattatcaactcgataacgggacaaccaatgtgttc
gtggtgtttcctataccaaataattgtattttatctatcaacggcaacggatgcaattta
tccgaagccacaaaaacattgacgcgtgttcaattactgaaggcggattatagagacata
ccactggaacccaatcacaaatctttcagtataatcgcccccaacataacaataccaaca
tctcaaacgtcgtatgtttgttcgatacaaaagttacctaagtttcgaaccaaagtccat
gccatcgggtttgaaagcgtgatcgccaacccgggattggttcatcatattgaggttttt
attcatgtggtggccgcatgggcgtttggggcagaccctttctattatcccagagaagca
ggaatggcgttcggggtgaagacggcaagttcatatgttagattggaggttcattacaac
aacccaatgcatattagaggacttgtcgatggttcggggattcggtttcacttcacagag
aaccttcgaccgcatgatcttggaataatggaagttggtgttatatattctgccaacatg
gcgattccaccaggacagaagtcttttaaatggagtggtgaatgcccaggcagttgcaca
caagcaggtgattccctaataactacgtgcacatttaacaccgaaaatagaagcaatata
acattgggtgggctgggtttacacgaagagatgtgcgtcgattatatttattattaccct
gctaccaatcttgaagtttgtaaaagttccatctcaagtcaagcgttggaaatgtatttc
aaattaattaaactgtcgttggggattccccgcccccgtaattcccgccctcttcaccat
gaatatgacgtcataaagtggggaaactcggctgttcgttctcttcgtcagctctatcgt
ttcgctccaatgcaggtcaattgtctgaggagtaatggtgagagctaccccggtcgttgg
gacaacattacaccagcaacacatttccccagagcaatggaaccgcaatgttatgctaat
aataaaccatga

DBGET integrated database retrieval system