KEGG   Ciona intestinalis (sea squirt): 100176680Help
Entry
100176680         CDS       T01056                                 

Definition
dopamine beta-hydroxylase-like
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cin00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 418 aa AA seqDB search
MTIEVRNIMLGGSYSFGFGFSDDENMGDGDLIVVRVTRTSVAIKDCWLYTNGKVVEDSKH
SYKLLGYQYSNGVWNIKVERKFQTCDGEDYQLDNGTTNVFVVFPIPNNCILSINGNGCNL
SEATKTLTRVQLLKADYRDIPLEPNHKSFSIIAPNITIPTSQTSYVCSIQKLPKFRTKVH
AIGHVVAAWAFGADPFYYPREAGMAFGVKTASSYVRLEVHYNNPMHIRGLVDGSGIRFHF
TENLRPHDLGIMEVGVIYSANMAIPPGQKSFKWSGECPGSCTQAGDSLITTCTFNTENRS
NITLGGLGLHEEMCVDYIYYYPATNLEVCKSSISSQALEMSLGIPRPRNSRPLHHEYDVI
KWGNSAVRSLRQLYRFAPMQVNCLRSNGESYPGRWDNITPATHFPRAMEPQCYANNKP
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgactattgaagtgagaaacattatgttggggggttcatattcgtttgggtttggtttc
tctgatgacgagaatatgggagatggtgacctcattgttgttcgtgtaacaagaaccagc
gtggcgattaaagattgttggctttatactaatggtaaggtcgttgaagattcgaaacat
agctacaagttacttggataccaatatagtaatggcgtttggaacatcaaggttgaaaga
aagtttcaaacatgcgatggagaagattatcaactcgataacgggacaaccaatgtgttc
gtggtgtttcctataccaaataattgtattttatctatcaacggcaacggatgcaattta
tccgaagccacaaaaacattgacgcgtgttcaattactgaaggcggattatagagacata
ccactggaacccaatcacaaatctttcagtataatcgcccccaacataacaataccaaca
tctcaaacgtcgtatgtttgttcgatacaaaagttacctaagtttcgaaccaaagtccat
gccatcggtcatgtggtggccgcatgggcgtttggggcagaccctttctattatcccaga
gaagcaggaatggcgttcggggtgaagacggcaagttcatatgttagattggaggttcat
tacaacaacccaatgcatattagaggacttgtcgatggttcggggattcggtttcacttc
acagagaaccttcgaccgcatgatcttggaataatggaagttggtgttatatattctgcc
aacatggcgattccaccaggacagaagtcttttaaatggagtggtgaatgcccaggcagt
tgcacacaagcaggtgattccctaataactacgtgcacatttaacaccgaaaatagaagc
aatataacattgggtgggctgggtttacacgaagagatgtgcgtcgattatatttattat
taccctgctaccaatcttgaagtttgtaaaagttccatctcaagtcaagcgttggaaatg
tcgttggggattccccgcccccgtaattcccgccctcttcaccatgaatatgacgtcata
aagtggggaaactcggctgttcgttctcttcgtcagctctatcgtttcgctccaatgcag
gtcaattgtctgaggagtaatggtgagagctaccccggtcgttgggacaacattacacca
gcaacacatttccccagagcaatggaaccgcaatgttatgctaataataaaccatga

DBGET integrated database retrieval system