KEGG   Ciona intestinalis (sea squirt): 100176705Help
Entry
100176705         CDS       T01056                                 

Definition
uncharacterized LOC100176705
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cin00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100176705
Enzymes [BR:cin01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100176705
Peptidases [BR:cin01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100176705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1094 aa AA seqDB search
MAKPKDLYIAKSLKDLNKHTDSKCEKGRSIKIYLNFANKAFAEAEKAFKSRDEERAYILY
MKYLDMVGIVRKCPEFKKDTQHYSLLLGKMNTITALENAEATSNSLKKRYDALAKKAAEA
EMKQVEGKIKQNGAVEEFSHPVPDEEKVTETPEKETFGNEVNSAKLYELIYKKSKDVLIL
DIRSSEDFQMSHVQHSICANVPKAAIQPGTVVSKIEEGIAPSDMEMWNKRDSVDLVVLLD
WTSSVKRLQDKGDPLRSLKDAIWKWNQDKILQHEPVVLEGGFSDWLEFYPQFTTNPKAKV
PKANVKTLNVNSLLEFSYSDLNTNFVKPKPPPEKKEPEIKAELPTKPIPFTVNVPNSIPI
TIAQTNPPKQVSVSNTILKLVTPASEPVETPLPQKKKPQPMFDRSKKPSPAPAVHPSVPK
PESQFKKNGESPKNEMEVVKPSPPSKVKSKDVDNDAIFSEYEQRIALMVKQKEEKENAIV
EIEKKKKVAELQALEKKLKEEAEETEKRKMEAERQLAMTMRDLSKPKPITNNMEKPLVIE
PPNKKDDAPINKDMSPEPIYAEVKKTKIPKETPGNNKAKQKAPKPERPTAEKPDVSIPSK
SVASPVDQSKSTTVSSQHETQVKPKLSQSAPAISKPVDPIKPTTNQSTTKDVAIKQNKDQ
EKTVPPKPQEVKPISRKPTLSTGLNPNSDKGGFALKRSSSSPNINKLVEEESKVVSTSTM
PSIPDRERKPSIRPGPSELVTALTHSLRGVYGGKGRGLCGLRNLGNSCYMNSVLQCMFNM
TQLAEYILTDSYTKDLNRANKIGHGGRVAESFSVLLRAVWSSKYEYIVPSDFKSIIGTIN
SSFAGYTQEDSQEFLMLLLDGLHEDLNKAPQSEYKEEPDNDALDDEEAAQMAWKYHKKRN
ESIIVELLKGQFKATVKCLHCGKASRKFDPFMYLSLPLPNKSASIYDILKSFQRVEQMTG
SDRWHCPNCKTLRDAVRSIEIWKLPPVLIIHFKRFVHTGRWRDKIHTNISYPMTQLDLTP
FISGKQRRPKYNLFAVSHHQGAGLDSGHYTASCKSVLDNNWYKFDDTEVMRTSAPQGPTA
SILFYCCYQRHVPN
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacctaaagatttgtacattgctaaatctttgaaggatcttaacaagcatact
gacagcaaatgcgaaaaaggacgtagcatcaaaatctacttgaactttgctaacaaggca
ttcgctgaggccgaaaaggccttcaaaagccgtgatgaagaaagagcttacatcctgtat
atgaagtacctggatatggtggggatagtcaggaaatgccccgagtttaaaaaagacact
cagcattattctctgttgcttggtaaaatgaatacaatcactgcattggaaaatgcagag
gcaacatcaaacagtttaaagaaaagatacgatgctttggcgaaaaaggctgcagaagcg
gaaatgaagcaagtggaaggtaaaatcaaacaaaatggtgcagttgaagaattttcccat
cctgttcctgatgaagaaaaagtcacagaaacaccagaaaaagaaacatttggaaatgaa
gtaaacagtgcaaagttgtatgaattgatttacaaaaagtcaaaagatgttttaatactt
gacatacggtcttcggaagattttcaaatgtctcacgtgcagcattccatctgcgctaat
gtgcctaaggcagcaatccaacctggaacagttgtgtccaaaatagaagaagggattgca
ccaagtgatatggagatgtggaataaaagagactcggtagacttggttgttcttctggat
tggacttcctctgtcaaacgattacaagacaaaggagatcctctgaggagtttaaaagat
gcaatctggaagtggaaccaggataagatcttgcagcatgaacctgttgtacttgagggt
ggattttcagattggttggaattttatccacaatttaccaccaacccaaaagccaaggtt
ccaaaagctaatgtgaagactctcaatgttaacagtttgttggagtttagttatagcgac
cttaataccaactttgtgaaacctaaaccacccccagagaagaaagagcccgagataaag
gcagaactcccaaccaaaccaataccattcactgttaatgtcccaaattctattcccatc
acaatagctcaaacaaatccaccaaagcaagtttcagtctccaacactattctcaagctt
gttactcctgcatcagaacctgttgaaactcctttaccgcagaagaagaaaccccaacct
atgtttgacagatccaagaaaccctcaccagctccagcagtacacccttctgtcccaaaa
ccagagtcacagtttaaaaagaatggagaatcaccgaaaaatgagatggaagttgtgaaa
ccatctcctccttctaaagtaaagagtaaggatgtagataatgatgccatcttcagtgag
tacgaacagcgaatagctctcatggtgaagcaaaaagaagaaaaggaaaatgccattgtc
gaaatagaaaagaagaaaaaggtagcggaactccaggctcttgaaaagaaactaaaagaa
gaagcagaagaaacagaaaagagaaagatggaggcagagcgtcaacttgctatgactatg
agagatctcagcaagcctaaaccaataacaaataatatggaaaaacctcttgttattgaa
ccaccaaataaaaaagatgacgcaccaatcaacaaagatatgtcaccagaaccaatttat
gctgaagttaaaaagaccaaaattcctaaagaaacacctggaaataacaaagccaaacaa
aaagctccaaaaccagaaagaccaacagctgagaaaccggatgtttcaataccttccaaa
tcagtagccagcccagtggatcagtcaaagtctacaacagtttcaagccaacatgaaaca
caagtcaaacccaagctaagtcaatctgcgcctgccatatcaaaacctgtagatccgatt
aaaccaacaacaaatcaatcaactacaaaggatgtagcgataaaacaaaacaaagatcag
gaaaaaacagttccaccaaaacctcaagaggtaaagcccatatctcgaaagccaacttta
tcaactgggttgaacccaaactctgataaaggaggatttgctttaaagcgttcgtcttct
tctcctaacattaataaactggtggaagaggagtctaaagttgtatctacttccactatg
ccaagtataccagacagggaaaggaaaccaagcattagacctggacccagtgaactggtg
actgcattaacccattcacttcgtggcgtgtatggtggtaaaggaaggggtttgtgtggg
cttagaaacctcgggaactcctgttacatgaactcggtgctgcagtgcatgttcaatatg
acacagcttgctgaatatattcttaccgatagttacacaaaagatcttaacagagcaaac
aagatagggcatggagggcgagtggcagaaagtttttcggtgcttttaagagcggtttgg
agctccaagtatgaatatatcgtgccgtcagattttaagagcataattgggacgataaat
tctagttttgctggctacacccaggaagattcgcaggagtttttgatgcttctgttggat
ggcttacatgaggatctaaacaaggcgcctcaaagtgaatataaagaggagccagacaat
gatgctttggatgatgaggaagctgcacaaatggcttggaaatatcacaagaagcgaaat
gaatcgattatagtcgagttgctgaagggtcagtttaaagccacagttaagtgcctgcat
tgtggaaaagcttcacgtaagtttgatcctttcatgtacctttctctaccacttccaaat
aagtcggcatcaatatacgacattctcaagtcgtttcaacgagtggaacagatgactgga
agtgaccggtggcattgccctaattgcaaaacactcagagatgcggtccgttcaattgaa
atatggaagctccctcccgttcttattattcacttcaaaaggttcgtacacaccggtcgc
tggagagataagatacacaccaacatttcctaccccatgacccagctagacttgactcct
ttcatcagtggcaagcagagacgaccaaagtacaatttatttgctgtgtcccaccatcaa
ggtgctggtttggatagtggtcattatacagcttcatgtaaaagcgtgcttgataataac
tggtataaatttgatgacacagaggtaatgagaacatctgcacctcaaggaccaacagct
tcaattctattttattgttgttatcaaaggcatgtccccaattaa

DBGET integrated database retrieval system