KEGG   Ciona intestinalis (sea squirt): 100176767Help
Entry
100176767         CDS       T01056                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 2-like
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100176767
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100176767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 605 aa AA seqDB search
MVNENDKSMLTKNIISGMYSQPHHHHHARTIADPPTHVGLPPIKSQAVGGIGDVVNGLQV
QQLFESHHDPSVAARGRGNAVGIMQVKKNVSAPTSGAAKRRPSLPSVREPQTKDSTSQVT
GHAYQVSPARRALAPQQTRKGSGPNDSGSTLTGSAKSKGDRDSVQSYISPDEAMKQFMQK
LTSYEHHEVFSYPRIYFTGTSAKKRPGVVGASNNCGYDDDQCSYIAVPHDHIAYRYEILK
VIGKGSFGQVMKAFDHKLHQHVALKIVRNEKRFHRQAAEEIRILEHLRKQDKDNAMNIIH
MMESFTFRNHICMTFELLSINLYELIKKNKFQGFSLQLVRKFAHSILQCLEALSRNRIIH
CDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGGRYGMPIDMW
SFGCILAELLTGYPLLPGEDEADQLACSIELLGMPPRRLLDQSKRAKNFISSKGHPRYCQ
VTTLSDGSTVLGPGRSRRGKLRGPPGQREWVTALKGCDDPLFTDFLRRCLDWDPAARMTP
SQALRHSWLRRRLPKPPGGATAHRGDNSTIKNHSSFNRQPSGNKAKDMSVTVAATTRTVL
PKIVG
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacgaaaacgataaaagcatgctcacgaagaatatcattagtggcatgtacagc
caaccgcaccatcatcaccacgccagaactattgccgatccgccaacacacgtaggcctg
ccaccaataaaaagtcaagcagtaggagggataggagacgtcgtcaacggcttgcaggta
caacagctgtttgaaagccaccacgatccgtcagtcgctgcaagaggccgcgggaacgca
gttggcattatgcaagtcaagaaaaacgtctctgcgccgacgtctggtgctgcaaagaga
aggccttccctgccatccgtcagagaaccccagactaaagacagcacgtcgcaagttact
ggccacgcataccaagtatcacctgcacgccgcgctcttgcgccccaacagaccaggaaa
ggttccggacccaacgattccggttccacgctgaccggctcagcgaaatcaaaaggcgac
agggattcagtgcagagctacatttcgcctgacgaagcaatgaagcagtttatgcaaaag
ttaacttcatacgagcaccatgaagtgttcagctacccgcgtatttacttcaccggtacc
tcagcaaagaaacggcctggcgttgttggtgcaagcaacaactgtggatacgatgacgac
caatgctcttacatagctgtaccacatgaccacatcgcatatcgctacgaaatcctgaaa
gttattggcaaaggaagttttgggcaggtcatgaaagcgtttgatcataaactacaccaa
catgtcgctttgaaaatcgtgaggaacgagaaacgtttccaccggcaagccgctgaagaa
atacgaatattagaacatcttaggaaacaagataaagacaatgcaatgaacataattcat
atgatggagagttttacgttccgaaaccacatctgtatgacgtttgaactacttagtatc
aacctctatgagctcataaagaagaataaattccaaggcttttcccttcagctggtgaga
aaattcgcccactcgattctacaatgtttggaagccttatcgcgcaaccgcattattcac
tgcgacttaaaacctgagaatatcctacttaaacagcaaggcagaagcgggattaaggtc
atagacttcggctcatcctgctacgagcaccagcgtgtctacacttatatccaatcccgg
ttctatcgcgctcctgaggttatcttaggcggcagatacggcatgccgatcgatatgtgg
agtttcgggtgcattctggccgaacttcttaccggttatcccctcctgccaggcgaggat
gaagcggaccaactagcttgctctatagagctactaggcatgccgccaaggcgtcttctt
gaccaatcaaaacgggctaagaatttcattagttcaaaaggccaccctcgttattgtcaa
gtgacaactttatcggatgggagcaccgtccttggtcccggccgctcccgtagaggaaag
cttagagggcctcctggtcagcgagaatgggttacagcgctcaaaggctgcgacgaccct
ctcttcaccgatttcctgcgtagatgtctagactgggacccggcagcgcgcatgacgcct
tcccaagccctacgtcactcctggcttcgtcggcgcctccccaaaccgcctggtggcgct
acagcgcaccgaggtgacaactcgaccattaaaaaccattcatcgtttaaccgtcaacca
tcaggaaacaaagccaaggacatgtcagtcaccgtcgccgcaaccacgcgtactgtgcta
cccaagatcgtaggatag

DBGET integrated database retrieval system