KEGG   Ciona intestinalis (sea squirt): 100176772Help
Entry
100176772         CDS       T01056                                 

Definition
NADH-cytochrome b5 reductase 3-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100176772
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     100176772
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 308 aa AA seqDB search
MVADATNQTSSSVFTFGITAAVIAVTLAYLKKKRDENAVKKTLLDPEVKYALKLIAKERI
THDTRKFVFALPSENHILGLTVGKHIFLSARVDGKLVVRPYTPVTSDDDKGHMDLVIKVY
FKDTHPKFPEGGKMSQYLEALPIGGTIDVRGPNGLIEYRTKSVFSVRYEKNGFSYAKRAK
EVAMIAGGTGITPMLQIIRQCLKDPSDHTKLSLLYANQTEDDILVRKELEECAKADPNHF
KLWYTLDRPPADWKYSTGFIDEDMIRDNLPAPGIDTLVLLCGPPPMIKFACLPNLEKVGH
QSGRICTF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggatgcaactaaccagacttctagctcagtgttcacttttggcattactgct
gcagtaattgcagtaacacttgcctacctgaagaaaaagcgagacgaaaatgcagtaaag
aaaactcttcttgatccagaagtcaagtatgccttgaaattgatagcaaaggaaagaatt
acacatgataccagaaaatttgtgttcgctcttccaagtgaaaatcacattttgggactg
acagttggcaagcatatttttctttcagcaagagttgatggcaaactagttgttcgacct
tatacccctgtcacatctgatgatgacaagggtcatatggacttggttataaaggtgtat
tttaaagatacccacccgaaatttcctgaaggtggaaaaatgtcccaatacttggaagct
ttacccattggtggcactattgatgttcgtggtcccaatggcttgattgagtacaggaca
aagagtgtcttttcagtgcgttatgagaaaaatggattttcttatgccaaaagagcaaaa
gaggttgctatgatagctggtggaactggtattactccgatgctgcaaattattcggcaa
tgcttaaaggacccttcagaccataccaagctctctctactttatgctaatcaaacagaa
gatgacattcttgtaaggaaggaattagaagaatgtgctaaagctgacccaaatcatttt
aaactgtggtataccctggaccgcccaccagcagactggaaatattctactgggtttatc
gatgaagacatgatccgtgataacttaccggctcctgggattgataccttagtgttactg
tgtggaccgccacctatgattaaatttgcttgcttaccaaaccttgaaaaggttgggcat
caatctggtcgaatctgcacattttaa

DBGET integrated database retrieval system