KEGG   Ciona intestinalis (sea squirt): 100176829Help
Entry
100176829         CDS       T01056                                 

Definition
(RefSeq) aurora kinase
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100176829
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   100176829
Protein phosphatases and associated proteins [BR:cin01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100176829
Chromosome [BR:cin03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100176829
   Spindle formation proteins
    100176829
  Sister chromatid separation proteins
   Aurora kinases
    100176829
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
7
AA seq 305 aa AA seqDB search
MSSANNENKAPEKASTSGRATASSAKDNASDTWSLKNFDIGKPLGRGKFGSVYLAREKKS
KFIVALKVLFKSQLMKSNVEHQLRREIEIQSHLRHPHILRLYGYFHDETRVYLILEYASR
GEMYKELQKQGKFTEEMSATYIAELADALNYCHSKQVIHRDIKPENLLMGLRGELKIADF
GWSVHAPSSKRQTLCGTLDYLPPEMIEAKDHDANVDLWTLGILCYEFLVGKPPFETKSTQ
ETYLRITSLKYSFPPHVSEGARDLIRRLLKLEPRHRLPLESVMAHPWIKANAKVHKFGPD
GRPMD
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagttctgccaacaatgaaaacaaagctcctgagaaagcttcaacatctggtcgtgct
actgctagttccgccaaagataatgcaagtgacacttggtcacttaaaaactttgacatt
ggcaaaccactgggacgaggaaagtttggcagcgtgtaccttgctagagagaaaaagagc
aagtttatcgttgcactgaaagtgctgtttaaatcgcaactcatgaaaagtaatgtggag
catcaattacgaagagagattgaaattcagtctcatttgcgtcatccacacattctgcga
ctttacggttactttcacgatgagacgagagtgtatctgatcctggagtatgcatctcgt
ggggaaatgtacaaggagctgcagaagcagggcaagtttacagaggagatgtccgctacg
tacatagccgagctagcagatgcgctcaactactgccacagcaaacaagtcattcatcgt
gacatcaaaccggagaacttgttgatgggtcttcgaggggaattgaagattgctgatttt
ggttggtctgtgcatgctccgtcctctaaacgccaaactctttgtggtacgcttgattac
ctcccaccagagatgattgaagcaaaagatcatgatgctaacgtcgacctgtggacactt
gggattctatgctatgagtttcttgttggcaaaccaccttttgaaacaaaaagcacacaa
gaaacatacctcagaattacatcactgaaatattcattccctccccatgtatcagaggga
gctcgtgatcttattcgtcgcctcttaaagttggaaccacgacaccgacttccactggaa
agtgtaatggctcacccctggatcaaagccaatgccaaagtacataagtttggaccagat
ggtcgacctatggactga

DBGET integrated database retrieval system