KEGG   Ciona intestinalis (sea squirt): 100176829Help
Entry
100176829         CDS       T01056                                 

Definition
aurora kinase A-like
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
cin  Ciona intestinalis (sea squirt)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 305 aa AA seqDB search
MSSANNENKAPEKASTSGRATASSAKDNASDTWSLKNFDIGKPLGRGKFGSVYLAREKKS
KFIVALKVLFKSQLMKSNVEHQLRREIEIQSHLRHPHILRLYGYFHDETRVYLILEYASR
GEMYKELQKQGKFTEEMSATYIAELADALNYCHSKQVIHRDIKPENLLMGLRGELKIADF
GWSVHAPSSKRQTLCGTLDYLPPEMIEAKDHDANVDLWTLGILCYEFLVGKPPFETKSTQ
ETYLRITSLKYSFPPHVSEGARDLIRRLLKLEPRHRLPLESVMAHPWIKANAKVHKFGPD
GRPMD
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagttctgccaacaatgaaaacaaagctcctgagaaagcttcaacatctggtcgtgct
actgctagttccgccaaagataatgcaagtgacacttggtcacttaaaaactttgacatt
ggcaaaccactgggacgaggaaagtttggcagcgtgtaccttgctagagagaaaaagagc
aagtttatcgttgcactgaaagtgctgtttaaatcgcaactcatgaaaagtaatgtggag
catcaattacgaagagagattgaaattcagtctcatttgcgtcatccacacattctgcga
ctttacggttactttcacgatgagacgagagtgtatctgatcctggagtatgcatctcgt
ggggaaatgtacaaggagctgcagaagcagggcaagtttacagaggagatgtccgctacg
tacatagccgagctagcagatgcgctcaactactgccacagcaaacaagtcattcatcgt
gacatcaaaccggagaacttgttgatgggtcttcgaggggaattgaagattgctgatttt
ggttggtctgtgcatgctccgtcctctaaacgccaaactctttgtggtacgcttgattac
ctcccaccagagatgattgaagcaaaagatcatgatgctaacgtcgacctgtggacactt
gggattctatgctatgagtttcttgttggcaaaccaccttttgaaacaaaaagcacacaa
gaaacatacctcagaattacatcactgaaatattcattccctccccatgtatcagaggga
gctcgtgatcttattcgtcgcctcttaaagttggaaccacgacaccgacttccactggaa
agtgtaatggctcacccctggatcaaagccaatgccaaagtacataagtttggaccagat
ggtcgacctatggactga

DBGET integrated database retrieval system