KEGG   Ciona intestinalis (sea squirt): 100176899Help
Entry
100176899         CDS       T01056                                 

Definition
uncharacterized LOC100176899
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
cin  Ciona intestinalis (sea squirt)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 683 aa AA seqDB search
MASQFTTEGLGDNPDKWFSMLQSCLNLQNGEEKNNLLKQIFVTANRSLTAEKHKTSEIYA
KILAEEAAFVGSTNVNKGRNMFKHAVYVCRTIPIIHLTYAQFEVRNGHFDKALHILEFGK
MVTGCKLLFEQAISKLENGYVKFNSTLSMDLNQATPLKNITNTECNEKVTECQKRSYTDT
ALKTPPSYRFRALDTKYYDIKTPSPPMLKMSPTNTFPNRFTFNMPTSISKSSVTNFTPTP
ASATKTTGLTKGPQRVLRSLKSSLENADNDKEHDIGTHQTPYSLKHHPLVSNVEPQIPDS
PKPPVIIDPSPINPPTPIIPLKKEIFPYPSKQTPQPKLTPNPPKNLGTLNPEIRQNPSKS
TPMKTDTSNLNHNSMPPPKKFPPQRVPCSKPAEPQNGLHTWFNPNSAICVNNKHYLVIRE
LGEGGSSKVLQVFCAETKAILALKKVSLKDCDESTKNEFTNEIEFLLKLRNNPHIVHLYD
FELTPDFIHLVMECGSTDLAKLLHSHKTQNSRLEVYEIIYFWKKMLLAVQTIHKHGVIHR
DLKPANFLLVKGNLKLIDFGISNAINADATSVIKETQCGTLNYMAPEAILDMSGGYNPDS
PKFKISPMADVWSLGCILYSMLYGCTPFQHIKHQLLKLNAITNDQHRIEFPPFKDENFVK
IVQKCLKRNPKHRPTVDQLLQFS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggcaagccagtttactacagaaggtcttggagataacccggacaaatggttcagtatg
cttcaaagttgcttaaacctacagaacggagaagagaaaaacaacttgttaaagcagatc
tttgtgacagcaaatcgttctcttactgcagaaaaacataaaacatctgaaatttatgct
aaaatattagcagaagaagcagcttttgttggttcaacaaatgtaaataaaggaagaaac
atgtttaaacatgccgtatatgtctgtcgtacaattccaatcatacaccttacgtacgct
cagtttgaagtgcgaaatggtcactttgacaaagcacttcatattcttgagttcggaaaa
atggtcactggatgtaaattattattcgaacaagcgatttctaagctggaaaatggatat
gtcaagtttaattcaactttatctatggatttaaatcaagctacacctttgaaaaacata
acgaatacagagtgcaacgaaaaagttacagaatgtcaaaaacgatcttatactgatacc
gcacttaaaacacccccatcttacagatttcgtgctttagacaccaaatattacgatata
aagacaccttctccaccaatgttaaaaatgtcacctacgaacacttttcccaaccgtttt
accttcaacatgccaacttctatcagcaaatcttctgtaactaatttcacacctacccct
gcttctgctaccaaaacaacaggtcttacgaaaggtcctcaaagagttttacgctcttta
aagagttccctagagaatgcagataatgataaagagcatgatattggaacacaccaaaca
ccttattcactgaaacatcatccactggtttcaaacgttgaaccccaaatcccggacagc
cccaaacccccagttataattgacccatcacccataaacccccctacccctattataccc
ctaaaaaaagaaattttcccctacccctcaaaacaaactccccagccaaaattaacccct
aaccccccaaaaaatcttggaacactcaatccagaaatcagacaaaatccgtcaaaatct
acacccatgaaaacagatacttcaaatttgaatcataacagtatgccaccacccaaaaag
tttccaccacaaagagtaccatgttccaaaccagcagagccacaaaatggtttgcataca
tggtttaacccaaacagtgctatctgtgtcaacaataaacattatttggtgataagggaa
ttaggggaaggtggttcaagtaaagtccttcaagttttctgcgctgaaaccaaagccata
cttgcacttaaaaaggtttcattgaaagattgcgatgagtcgacaaaaaatgagtttacc
aacgagattgaatttcttctcaagttgagaaataatccccacattgttcatttgtacgac
ttcgaactgacaccagatttcattcacttagtcatggagtgtggatctacagacttagcg
aaactactgcattcacataaaacacaaaatagccggctagaagtttacgaaattatatat
ttctggaagaaaatgctactcgctgtacaaactatacataaacatggagtcatacacagg
gatttaaagccagccaactttttattggtaaaaggaaatctaaaacttatcgattttgga
atttcaaatgcaataaatgctgatgctacaagtgtgattaaagagacgcagtgtggaaca
ttaaattacatggcaccagaagcaatactggatatgtctggtggatataaccctgactca
cctaagtttaagattagcccaatggctgacgtttggtcattgggctgcatcttatattct
atgctgtatggatgcacgccgtttcaacacattaaacatcaacttttaaaattaaatgca
ataaccaatgaccaacatagaattgaatttcccccgtttaaagatgaaaattttgtaaaa
attgttcaaaaatgtttaaaaagaaacccaaaacatagaccaactgtggaccaactttta
caattttcctaa

DBGET integrated database retrieval system