KEGG   Ciona intestinalis (sea squirt): 100176905Help
Entry
100176905         CDS       T01056                                 

Definition
histone H2B.1, embryonic-like
Orthology
K11252  
histone H2B
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100176905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 122 aa AA seqDB search
MVASKGPKKAMKSTPPVEKKERKNKRHRRRKESFGIYIYKVLKQVHPDTGISSKAMNIMN
SFVHDLFERVAGESSRLCSYNKRSTISSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS
SK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggttgcatccaaaggtcccaagaaagctatgaagagcacacctccagtagagaagaag
gaacgcaagaataagcgccatcgtcgacgaaaggaaagcttcggcatctacatttacaaa
gtgttgaagcaagtccaccctgacactggtatctccagcaaggcaatgaacatcatgaat
tcatttgttcacgacctattcgaaagagttgccggagaatcttctcgtctctgtagctac
aacaagcgctccactatcagcagtcgggaagtgcaaaccgcagttcgccttttgcttcca
ggggagcttgcaaaacatgctgtatcggagggtacaaaggctgttacaaagtacaccagc
tcaaagtaa

DBGET integrated database retrieval system