KEGG   Ciona intestinalis (sea squirt): 100176909Help
Entry
100176909         CDS       T01056                                 

Definition
ubiquitin carboxyl-terminal hydrolase 10-like
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
cin  Ciona intestinalis (sea squirt)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 714 aa AA seqDB search
MDLSSTMIEFGDFEVKLQQIYKHHECVELPTSWPPEDTHQLSFCFPEDIVGVEKPTDHVQ
DAVIVKSNDASLTEPPSNTPLCNGGGEKINDTCVVNGKISKEEIIYKEEDLKIPEKRKGK
QQAVNPVSVNKQIIRRKSSSGNENDDANKQVPSKDTITYSEINNNKKSSVHMDVNGIPDS
KNPKPVENHTHVVNGDSTNQRTTNTKLSTSEKQSPDSNIMLSQKSEQTKQSTPKQVTSWA
GLFRGSANTNGSSESTAPAPKQKQLPIRKNNNAQDSTPATEPDKRKSDANSAKPVRNGSA
AKSSLCLVKPSEDPNAKGIAEELHNMELIFKPQAFIPRGLTNTSNWCYINATLQALLVCP
PFYQFLKSISTFTPLSQKTVTCSPIIDSFLQLASEFRPLSTKRGFVTKEVRHGPPFEPRY
IYDMLTLIKSSLSEKGRQEDAEEFQSCVLNGLHEEMTQLFTYLNDSANSQSPESHSEQDD
SSSTSEELMNGDAEKEEWEEVMATKKNKSAVTRRADDTRTPISDMFRGELCTSVFRPGQK
VSVSYEPFFSLPLSVPADHACNVDDALMSLTDKESFLADGEGQSDASRQQTLESLPPIFI
LHLKRFVYDKSGGLKKIDKKVEYKTDMVIGKEMLSKSARKLSINQRTYKLFAVVYHHGEK
ATGGHYTTDVFHIGLSSWLRIDDQNIKTVHHTEVTRHNPSRTAYLLYYRRIDLG
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggatttaagctccactatgatagaattcggagattttgaagtaaagctgcaacagatt
tacaaacaccatgagtgtgtggagcttcctacatcctggcccccagaagatacacaccag
ttatcattttgcttcccggaggatatagttggtgttgaaaaaccaacagaccatgttcaa
gatgcggtcattgtaaagtcaaatgacgcttctttgactgaaccaccctccaacactccg
ttatgtaacggaggtggtgaaaaaataaatgacacttgtgttgtaaatggaaaaatatcc
aaagaggagattatatacaaagaagaagatttaaaaattcccgaaaagcgaaaggggaaa
caacaagcagtaaaccctgtttctgtaaataaacaaataattcgtcgcaaatcttccagt
gggaatgagaatgacgatgcaaacaaacaagtaccttcaaaggatacaataacatattct
gaaattaataacaataaaaaaagttcggtgcacatggatgtgaatggtattccagactct
aaaaatcctaaacctgtggaaaatcacacccatgttgtcaatggagattccaccaaccaa
aggactaccaacacaaaactttcaacatctgaaaaacaatcaccagactcgaacattatg
ttatctcaaaaatccgaacaaacgaaacaatctactccaaaacaagttaccagctgggct
ggactgtttcgtggttcagcgaacacaaatggaagcagtgaaagcactgctccagcaccc
aaacaaaaacagttacctattcgtaaaaataacaatgcgcaagacagtactcctgccaca
gaacctgataaacgaaagtcagacgcaaacagtgcgaaacctgtaagaaatggttctgct
gcaaaatcttcattgtgtcttgtgaaaccaagtgaagatccaaatgcaaagggaattgca
gaagagctacacaacatggagttaatattcaaaccacaagcattcataccacgtggactt
accaacactagcaattggtgctacatcaacgctacattacaagcgctgctggtgtgccca
cctttctatcagtttctgaaaagtatttctacatttactcccctgagtcagaagacagtg
acctgttcaccaatcatcgatagtttcttgcaactcgcttctgagtttcgacccctttcc
acaaagcgtggatttgtaacaaaagaagttcgtcacggacctccatttgagccacgatat
atttacgacatgcttactcttataaagtcgtcactatcagaaaagggtcgtcaagaagat
gctgaagaatttcagtcttgtgtattgaacggacttcatgaagagatgactcagctgttc
acgtatttgaatgactcagcaaactcacaatctccggaatctcactcagagcaagatgat
tcgtcctccacatcagaggaactgatgaacggagatgcagagaaggaggaatgggaagaa
gtcatggccactaagaagaataaatcggccgttacacgaagagctgatgatacaagaacc
ccgatatcagatatgttccgaggagagctatgcacttcagtttttcgacccgggcaaaaa
gtttctgtttcttacgaaccgttcttctcactgccgctgagtgttcctgcagaccatgca
tgtaatgtggatgatgctttgatgtcactcactgacaaagaaagtttccttgcagatggg
gaaggacagtctgatgcgtcacgccaacaaacactggaaagcttaccaccaatcttcatt
ctacatttaaaaagatttgtgtacgacaaatctggtggcttgaagaaaattgacaaaaaa
gttgaatataagactgacatggtcattgggaaagaaatgctttccaaatcagcaagaaag
ctgagcataaaccagagaacgtacaaactgtttgcagttgtataccaccatggagagaaa
gcaaccggtggtcactacacaaccgatgtgtttcatatcgggttaagttcgtggcttcga
atcgacgaccagaatatcaagactgtacatcacactgaggttacacgacataacccttca
cgaacggcttacttgctctattatcgcagaattgatcttggctga

DBGET integrated database retrieval system