KEGG   Ciona intestinalis (sea squirt): 100176945Help
Entry
100176945         CDS       T01056                                 

Definition
protein unc-13 homolog A-like
Orthology
K15293  
protein unc-13
Organism
cin  Ciona intestinalis (sea squirt)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 1518 aa AA seqDB search
MSLLCVKVKQGKLDGAPDKFNTYVSLKVQNVKSTTICVKGCDPLWEQDYMFEISRVDLGL
SIEIWNKGVLWDTLLGTAWLPLSHVPHCNEEGDGAWYQLYTNVNSDKGVVPDVKNATNHK
VLCDVRFELPCELSENEVVMLQQKLDEFNEYQDDTWMVDPFSSTLNKSNATSSISIDSDY
RSDVSVVGSYQTVQHANASSSQHREARALKKPKAGSLTTDEADSYSREYGSDTESFDSRC
QRYGSEEDAEADRQVGQEDVGLVLKHESYEDSPPKIPDDLANSAGDMSFSSAKFKWIHAF
NRVRIGLNGEREDQLGELHCSRKASLWNIGANSSFYTSIDSMPDIRPRKKSIPLVSDLSI
AMIKRQTGITSALVTSRASLNDEDLKLHVYKKTLQALIYPISCTTPHKFAIWSASTPTYC
YECEGLLWGIARQGLRCSECGVKCHEKCRDLLNADCLHRAAEKSSKHGAEDKTQHIITSM
KDRMKVRENSCPQLFQLMKSVFDVNYDSHHILMESAKQCVLDGTSKWSAKLSITVISAQG
LQAKDKTGSSDPYVTVQVGKTRKRTKTIYGDLNPLWNENFHFECHNSTDRIKVRVWDEDD
DIKSVLKQQFKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHINMEIK
GEEKVAPYHLQYTCLHENLFHYTCKQNNDMVKIPKMDGEESWKVYFDGQQQEIVDEFAMR
YGVESIYQAMTHFSCLSSKYKSSGAPAVMSALLANINAYYAHTSPTTHISASNRFAASNF
GTERFVKLLDQLHNSLRIDLSMYRKHFPASKPEKLIDLKSTVDLLTSITFFRMKVQELQS
PPRAGQVVKDCCKACIRSTYGYVFSNCSEISQTDKTEEGPEEGGPRIDDLDFWTQLITLM
VSVIEEDKNIYTNYLNQFPSEFNVGQVCAGEMWKMFSEDLEKGLLEHAQHRLCKTTDYMN
LQFKVKWLYKEYVAPLDMFQDAVPEYSQWFEPFTMDWLDVNEKLSMDFLSGAYERDRRDS
FQQSSEHALFSCSVVDIFTQLNQSYDIIKKLECPDPQVVNQFMTKFAKTIEKVLDTYAEM
VSKDFPKLCAKEDTACVLMNNIQQLRVLLENLFRNMGGEQLDSVTSDILKSLQVKLNVRL
GELSEIFGQSFTQRIDNSIKAMGNLLCKIKGNANISIQQRSSDNIAHEADNVLRPLMDLL
NGSLEMFAKTCEKTVLKHVLKELWKLVVKSLETSIVLPPLNDITGSQLLRNAAKEISQFS
KFRDLAREDVSRNLSPRQCYILDASLDSIKQYFHAGGKGLRKNYLEKSEELQSLKYALSL
YTQTTDSLIKTFIETQTTQDEPSVESPQGEVSIQVDIYTHPGTGENKLTIKVVAASNLKW
NTTGMFRPFVDVNLVGPHLSNVRRRYSTKSRSNAWSPKYNESFSYSIGNVEKISAYELHL
CVKDYCFARDDRVIGVAVMQLRNISQQGSCACWCSLGKNIHLNQTGWTVLRILSQRAGDE
IAKEFVQLKSSTRSLEEA
NT seq 4557 nt NT seq  +upstreamnt  +downstreamnt
atgtctctactttgtgttaaagtcaaacaagggaaacttgatggggcccctgacaaattc
aacacgtatgtctcattgaaagtacaaaacgttaagagcacaacaatatgtgtgaaagga
tgtgatccactttgggagcaggattacatgttcgaaatcagcagggtagatctgggactt
tctattgagatctggaacaaaggagttctttgggacactttgctgggcacagcctggtta
ccactttcacacgtaccacactgtaatgaggaaggagatggtgcgtggtatcaactttat
accaatgtgaattctgacaagggagttgtgccagatgtaaagaatgctactaaccacaag
gtcttatgtgacgtacgttttgaacttccgtgtgaactttctgaaaacgaggtggtcatg
ctgcagcaaaaacttgacgagttcaatgaatatcaagatgacacctggatggtggatccg
ttctccagcacattgaataagagcaatgcaacaagttcaatttcaatcgacagtgattac
aggagtgatgtgagtgttgtaggttcgtaccaaacagtgcagcacgccaacgcctcatct
tcacaacatagagaagcaagagctttaaagaaaccaaaagctggaagtttgacaacggat
gaagcggatagttattctcgtgaatatggatcggatactgaatcttttgactcccgatgc
cagaggtacggaagtgaggaagatgctgaagccgaccgacaagtcggacaagaggatgta
ggtttggtgctgaaacatgaaagttatgaagacagcccacccaaaatacctgatgatcta
gccaattctgctggtgatatgtcattttcttctgccaagtttaaatggattcatgcattt
aatcgtgtaagaataggtttaaatggagaacgtgaagatcagctcggtgaactccactgt
tcgaggaaagcatcgttgtggaacattggagctaacagcagtttttatacaagcattgac
agcatgcctgatattcgaccaaggaaaaaatcaatacctttggtcagtgatctatctatt
gcaatgataaaaagacaaactggaataacttctgctcttgtaacgtcacgggcatctttg
aatgatgaagatttaaaacttcatgtttacaagaagactttacaggcattgatataccct
atttcttgtaccacacctcataaatttgctatctggtctgcttccacacccacatattgc
tatgagtgtgaaggtttattgtgggggattgcaagacaagggttaaggtgctctgagtgt
ggggttaagtgccatgagaaatgtagagatctgctgaatgctgattgtcttcatcgtgca
gcagaaaagagctccaaacacggtgctgaagataaaactcaacacataatcacatcaatg
aaagatcgaatgaaagtgagagagaatagttgtccccaactcttccagttaatgaagtct
gtatttgatgtgaactacgactcccatcatattttaatggagtcggccaagcaatgtgtg
ttggatggaacctcaaaatggtcagcaaagctcagtattactgtaatcagtgcacagggc
ttacaggcaaaagataaaactggctccagtgatccttatgtcactgtacaggttgggaag
acaaggaaaagaaccaaaacaatctatggagaccttaaccccctgtggaatgaaaacttt
cactttgagtgtcataattcaacggaccgcattaaagttcgggtttgggacgaagatgac
gacattaagtcagtcctgaagcaacagtttaagagagaatctgatgatttccttggtcaa
actattatcgaggtgagaactttatctggtgagatggatgtttggtataatcttgaaaaa
agaacagacaagtcagctgtgtctggagcaattcgtctgcacataaatatggaaatcaag
ggggaagagaaagtagcgccttaccacctgcagtacacttgtctacatgagaaccttttc
cattatacttgcaaacagaataatgacatggttaagattcctaaaatggacggagaggaa
tcgtggaaagtttattttgatggacagcagcaggaaattgtggatgagtttgccatgcgg
tatggtgtggaatcaatatatcaggccatgactcatttttcatgcctgtcatctaagtac
aaaagttccggcgccccagctgtcatgagtgcattgctggcaaatattaacgcttactat
gcgcacacctcaccaaccactcatatatcagcaagcaacaggttcgctgcatccaacttt
ggcacagagaggtttgtgaagctccttgaccagctgcacaactctctacgtattgatcta
tcaatgtatagaaagcatttccctgcttctaagccagaaaaactcattgacctcaaatcc
actgtcgatctgttaactagcatcacctttttccggatgaaagtacaagaactacagagt
ccgccacgtgcaggccaagtggtaaaagattgctgcaaagcatgtattcgctcaacatat
ggttatgtcttcagcaattgttcagagatttctcagactgataaaactgaggagggtcca
gaggaaggaggacctcggattgatgacctagatttttggactcagcttattacgttgatg
gtgtcagtcattgaggaagataaaaacatctataccaactatcttaaccaatttcccagt
gagttcaatgtggggcaagtgtgtgcaggtgaaatgtggaaaatgttttcagaagatctg
gagaaggggttgctagagcatgctcaacacaggctgtgtaaaaccactgattacatgaat
ctgcagttcaaagttaaatggctgtataaggagtatgtggccccacttgatatgttccaa
gatgccgtgccggagtattcacaatggtttgaaccttttaccatggactggcttgatgtg
aatgagaaattgtcgatggattttctcagtggagcatatgaacgtgatcgacgtgacagc
ttccagcaaagttctgaacatgcattgttctcgtgttctgttgttgacatcttcactcaa
cttaaccagagttacgatattataaagaaactggagtgtcctgatccccaggtcgtaaat
caattcatgactaaatttgcgaaaaccattgagaaggtacttgacacatacgctgaaatg
gtgtcaaaagatttcccaaaactttgtgcaaaagaggacactgcatgtgtgcttatgaac
aacatacagcagctgagggtgttgctggaaaatctgtttagaaacatgggaggtgaacaa
cttgattctgtcacaagcgacattttaaaaagtttgcaagttaaactcaacgttcgcctt
ggagaactcagtgaaatatttggccaaagttttacacagaggattgacaacagcattaaa
gcaatgggaaacttgctgtgtaagataaaaggcaatgccaatattagcattcaacaaaga
tcaagtgataacattgcacacgaggctgataacgtattgcggccactgatggatcttttg
aatggaagcttggagatgtttgccaagacctgtgaaaaaacagttctgaaacatgttctg
aaagagctgtggaagctggttgttaagagtctagaaacttctattgttctcccgccattg
aatgatattaccggttcccaacttctacgcaatgcagcgaaggaaatatctcagttctcc
aaattcagggaccttgcacgggaagacgtcagcagaaacttgtctccccgacaatgttac
attttggacgcctcactcgactccatcaagcaatactttcatgctggtggaaaagggttg
cgtaaaaattacctggagaagagtgaagagttacaatcattgaagtatgcactgtcactg
tatacacaaactacggactctttgatcaaaacattcattgaaacacaaactacacaggat
gaaccaagcgtagaaagcccacaaggagaagtttcgatccaagtagacatatacacacat
ccaggcactggggaaaacaaacttacaattaaggttgtggccgcaagcaacctaaaatgg
aacacaacaggaatgttccggccatttgtagatgttaaccttgtaggacctcatctaagc
aacgttcgacgaaggtattcaacaaaaagtcgaagcaatgcgtggtcaccaaagtacaat
gaatctttcagttactcgatcggtaacgtggaaaaaatctccgcttacgagcttcactta
tgtgtaaaagattattgctttgcacgagacgaccgtgttattggagttgcagtgatgcag
cttcgtaacatatctcaacaaggttcatgcgcctgttggtgctcactcggtaaaaacatt
cacctgaaccagacgggctggacagttttacgaatactgtctcagcgtgctggtgatgaa
attgctaaagaatttgttcagcttaagtccagcacacgctcgctggaagaagcttaa

DBGET integrated database retrieval system