KEGG   Ciona intestinalis (sea squirt): 100177088Help
Entry
100177088         CDS       T01056                                 

Definition
proto-oncogene serine/threonine-protein kinase mos-like
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100177088
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: Other group
  MOS family
   100177088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 564 aa AA seqDB search
MSSPISKFRSFSRIFTSASPKPAASRSFVFDQSVISNSQSSPALTSACVARSVRTPPTKS
KSPGACSTPMVQKAQNRCTGLVDEVYPQRSFTPSKISSRVKMNISPYKYLCLTSRKRHLG
VSDGLSYKPKPNAPKRKDSFYSAKNRSPCPRRRCSVFSTSVAPTNTPKNDGKIFRLSGVS
LSPSTVSWTAESPVQFVSDTTTSSQSRFRWNSCSSDGCSRRLQRHVEQCPPGKLYFWEDD
ESELETAIQLGRGGFGRVFEGNYRGQKVAIKKLENASKSRQAILETMQGEMYGLRLQHLN
IVRTLVVMQPTFSPENKNPSNTCYVVMEHAGNRNLAQLLNNSDEEISMGRKIRFASDILQ
GITYLHERRLVHLDLKPSNVIVTSEDTCKICDFGSCMSISSPRLNQPNMSQLNTTRSGIS
LDNRDANTSQACDSAINQSTSYMSFSSTGSAHSSSCLMGTFVYRAPELLRGFFPTTKADI
YSFGITAWQLWSRKQPYAGQHNHAAVFSVVAFGSRPKIPDYMDYCDLAEASSLKQYFDVV
TSCWNADADLRPTAEQAIAALAKC
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctccaatttcaaaatttcgatcgttttctcgaatctttacatcagcgtctcca
aagccagctgcttctcgttcttttgtatttgatcaatcagtgatctcaaactctcaaagt
tcgccagctctaacatcagcatgcgttgcaaggagcgtaagaactccgccaacgaaatca
aaatcaccaggagcatgctcaacaccaatggttcaaaaagctcaaaatcgatgcactggc
ctggtggacgaagtttatccacaaagaagtttcacgccaagcaaaatatcctctcgggtt
aagatgaacataagtccttacaaatatctttgtttaacttcgaggaagcggcatttagga
gtgagtgacggcctttcttacaaaccaaagccaaatgcaccaaaacgcaaggattcgttt
tactccgcaaagaaccgatctccatgtcccagaagaagatgtagcgtctttagtacatca
gttgctcccaccaacactccgaaaaacgacggaaaaatatttcgattaagtggtgtttca
ttaagtccatcgacagtctcatggacggccgaaagtccggtacaattcgtctccgataca
acgacgtcatcacaatctcgttttcgttggaactcctgctcttccgacggctgctcacgt
cgcctccagcgacacgtggagcagtgtcctcccggaaaactgtacttttgggaagatgat
gaatcggagttagaaacagcgatccaacttggtagaggagggttcggccgcgtatttgaa
ggcaactaccgtggccagaaggtggcgataaagaaactggagaacgcgtcaaagtcgcgc
caagctattctggaaactatgcagggtgaaatgtacggacttcgactgcaacatttgaac
atagtgcgaactctggtagtgatgcaaccgacgttttcaccagaaaataaaaacccgtca
aacacatgctatgtagtgatggaacatgctggaaaccgaaatctcgcccaattgctcaac
aattccgatgaagaaatatcaatgggcagaaaaataagattcgcttccgacattttgcaa
ggcatcacgtatcttcatgaacgccgattggttcatcttgatttaaaaccaagtaacgtg
attgtgacgtcagaggacacgtgcaaaatttgtgactttggttcttgtatgtcgatctca
agtccgaggttgaaccagccgaatatgtcacagctgaacacaacccgaagtggaatcagt
cttgataatcgtgatgcaaacacaagtcaagcctgtgattctgcaatcaatcaatcaaca
agttacatgtcattctcatcaactggttccgcccattcgtcatcttgtttgatgggcacg
ttcgtataccgagcgcctgaattgttgcgaggattcttcccgaccacaaaagcggatata
tattcctttggcataaccgcttggcagttatggagtcgcaaacagccatacgcgggccaa
cacaaccacgcagcggttttctcagtcgtcgccttcggatcgagacccaagataccggat
tacatggattactgtgatttagccgaggcatcttcgctgaaacaatatttcgatgtggtg
acgtcatgttggaatgctgatgccgatcttcgacctactgcagagcaagctatagccgca
ttagcaaagtgctag

DBGET integrated database retrieval system