KEGG   Ciona intestinalis (sea squirt): 100177145Help
Entry
100177145         CDS       T01056                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK1
  KO
K06631  
polo-like kinase 1 [EC:2.7.11.21]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100177145
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     100177145
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: Other group
  PLK family [OT]
   100177145
Chromosome [BR:cin03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100177145
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100177145
  Sister chromatid separation proteins
   Polo kinases
    100177145
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 572 aa AA seqDB search
MSRKDIPMKEIPEILKDVSTGKKYQRGRFLGKGGFAKCYEIVDLETKKIFAGKIVPKALL
VKPHQKDKMAQEITLHRSVSHENVVGFHGFFEDSDFVYVVLELCRRRSLMELHKRRKAVT
EPEARYYMRQIILGMQYLHSKKIIHRDLKLGNLFLTDDMEIKIGDLGLATQVDFDGERKK
TLCGTPNYIAPEVLGKKGHSYEVDIWSLGCIMYTLLIGKPPFETTSLKETYSRIKKNEYR
IPPSISPIARNLITKMLRNDPPSRPSVHNLLQDDFFTCGYLPPRLPTTCLSIAPRFTPAL
LNSAQRKPLHDINNAGSTNSAAATLKCEPASQNDVESPDFHMDDLMKQLITLIDSNPSQR
RLIEMDEAEDPAANPVLWISKWVDYTDKYGLGYQLCDNSNGVLFNDCTRLLLYNNDEQIE
YIDKEMSESYHTLKSYPDTLTKKVTLLKYFRNYMSEHLLKAGANMAPKEGDQFSRLPFLR
TWFRTRSAIILHLSNGTLQINFFNDHTKIILCPLMGAVTYIDVTKKFCTYRLTQLQKHGC
CRELAHRLRYARTMLEKLISSRSTTVRQKDIA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgaaaagacatcccaatgaaagagattccagaaatactcaaagatgtttcaact
ggtaaaaaataccagcgaggacgttttcttggcaagggaggttttgcaaagtgctatgaa
attgtggatttggaaacgaaaaaaatatttgcaggaaaaattgtgccaaaggcgcttttg
gtaaaaccgcaccaaaaggataaaatggcacaagagatcacgttacatcgaagtgtctcg
catgaaaacgtcgttggttttcatggatttttcgaagattccgactttgtttatgttgtg
cttgagctatgcagaagaaggtcgctcatggagttgcacaaaaggcgaaaagctgtcacc
gagccagaagcgagatattacatgcgacaaattatcctcggtatgcaatacctgcattcc
aagaagataatacacagagacctgaagcttggcaatttgttcttgactgatgacatggag
ataaagattggagatctcgggctggctactcaagttgatttcgacggtgaacgtaagaaa
actttgtgtggaacacccaactatatcgcgcctgaggttctggggaagaagggacatagt
tacgaggtggatatctggtcactcggatgtatcatgtacaccttattaattggcaaacca
ccgttcgaaacaacttcattgaaggaaacttactcaagaatcaagaagaatgaatatcgt
attccaccgtctatttctccaatcgcaaggaaccttatcacaaagatgcttcgaaatgat
ccaccttctcgaccgtccgttcacaatttacttcaagatgatttcttcacgtgcggttac
ctcccaccacgcctcccaaccacttgtctctccatcgctccacgatttacaccggcactt
cttaactctgctcaacggaaaccactgcatgatattaacaacgctggttccaccaactct
gcagcagcgaccttgaaatgtgaacctgcttcacagaatgacgttgaatcaccagatttt
catatggatgatctaatgaaacaactcatcacgctcatagattccaacccatcacagcgg
agacttatcgaaatggatgaggcagaagacccggcagccaaccctgtgttgtggataagt
aaatgggtggattataccgacaaatatggactaggttaccagctatgtgacaacagcaat
ggtgttttattcaatgattgcacaagacttcttctttacaacaacgatgaacagattgaa
tacatagacaaggagatgagcgaatcttatcatacgttgaagtcctatcctgatacactt
acaaagaaagtcactctgcttaaatatttccgaaactacatgtcagaacatctgcttaag
gcgggagcaaacatggcccccaaggaaggcgatcaattttctcgcctcccgtttctccgc
acatggttccgcacgagaagtgccatcatcctccacctcagcaacggaaccttacagatc
aatttctttaacgaccacacaaaaatcattctgtgtccattgatgggtgctgttacatac
attgatgtcacgaaaaagttctgtacctaccgtttgacacaactacaaaaacacggttgt
tgtcgggagttggcccatcgactacgctatgcacgcacgatgctggaaaagctcatttcc
agtcgttctacaacagttagacaaaaagatattgcgtga

DBGET integrated database retrieval system