KEGG   Ciona intestinalis (sea squirt): 100177145Help
Entry
100177145         CDS       T01056                                 

Definition
serine/threonine-protein kinase PLK1-like
Orthology
K06631  
polo-like kinase 1 [EC:2.7.11.21]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cin04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 463 aa AA seqDB search
MELHKRRKAVTEPEARYYMRQIILGMQYLHSKKIIHRDLKLGNLFLTDDMEIKIGDLGLA
TQVDFDGERKKTLCGTPNYIAPEVLGKKGHSYEVDIWSLGCIMYTLLIGKPPFETTSLKE
TYSRIKKNEYRIPPSISPIARNLITKMLRNDPPSRPSVHNLLQDDFFTCGYLPPRLPTTC
LSIAPRFTPALLNSAQRKPLHDINNAGSTNSAAATLKCEPASQNDVESPDFHMDDLMKQL
ITLIDSNPSQRRLIEMDEAEDPAANPVLWISKWVDYTDKYGLGYQLCDNSNGVLFNDCTR
LLLYNNDEQIEYIDKEMSESYHTLKSYPDTLTKKVTLLKYFRNYMSEHLLKAGANMAPKE
GDQFSRLPFLRTWFRTRSAIILHLSNGTLQINFFNDHTKIILCPLMGAVTYIDVTKKFCT
YRLTQLQKHGCCRELAHRLRYARTMLEKLISSRSTTVRQKDIA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggagttgcacaaaaggcgaaaagctgtcaccgagccagaagcgagatattacatgcga
caaattatcctcggtatgcaatacctgcattccaagaagataatacacagagacctgaag
cttggcaatttgttcttgactgatgacatggagataaagattggagatctcgggctggct
actcaagttgatttcgacggtgaacgtaagaaaactttgtgtggaacacccaactatatc
gcgcctgaggttctggggaagaagggacatagttacgaggtggatatctggtcactcgga
tgtatcatgtacaccttattaattggcaaaccaccgttcgaaacaacttcattgaaggaa
acttactcaagaatcaagaagaatgaatatcgtattccaccgtctatttctccaatcgca
aggaaccttatcacaaagatgcttcgaaatgatccaccttctcgaccgtccgttcacaat
ttacttcaagatgatttcttcacgtgcggttacctcccaccacgcctcccaaccacttgt
ctctccatcgctccacgatttacaccggcacttcttaactctgctcaacggaaaccactg
catgatattaacaacgctggttccaccaactctgcagcagcgaccttgaaatgtgaacct
gcttcacagaatgacgttgaatcaccagattttcatatggatgatctaatgaaacaactc
atcacgctcatagattccaacccatcacagcggagacttatcgaaatggatgaggcagaa
gacccggcagccaaccctgtgttgtggataagtaaatgggtggattataccgacaaatat
ggactaggttaccagctatgtgacaacagcaatggtgttttattcaatgattgcacaaga
cttcttctttacaacaacgatgaacagattgaatacatagacaaggagatgagcgaatct
tatcatacgttgaagtcctatcctgatacacttacaaagaaagtcactctgcttaaatat
ttccgaaactacatgtcagaacatctgcttaaggcgggagcaaacatggcccccaaggaa
ggcgatcaattttctcgcctcccgtttctccgcacatggttccgcacgagaagtgccatc
atcctccacctcagcaacggaaccttacagatcaatttctttaacgaccacacaaaaatc
attctgtgtccattgatgggtgctgttacatacattgatgtcacgaaaaagttctgtacc
taccgtttgacacaactacaaaaacacggttgttgtcgggagttggcccatcgactacgc
tatgcacgcacgatgctggaaaagctcatttccagtcgttctacaacagttagacaaaaa
gatattgcgtga

DBGET integrated database retrieval system