KEGG   Ciona intestinalis (sea squirt): 100177145Help
Entry
100177145         CDS       T01056                                 

Definition
serine/threonine-protein kinase PLK1
Orthology
K06631  
polo-like kinase 1 [EC:2.7.11.21]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100177145
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     100177145
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: Other group
  PLK family [OT]
   100177145
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 572 aa AA seqDB search
MSRKDIPMKEIPEILKDVSTGKKYQRGRFLGKGGFAKCYEIVDLETKKIFAGKIVPKALL
VKPHQKDKMAQEITLHRSVSHENVVGFHGFFEDSDFVYVVLELCRRRSLMELHKRRKAVT
EPEARYYMRQIILGMQYLHSKKIIHRDLKLGNLFLTDDMEIKIGDLGLATQVDFDGERKK
TLCGTPNYIAPEVLGKKGHSYEVDIWSLGCIMYTLLIGKPPFETTSLKETYSRIKKNEYR
IPPSISPIARNLITKMLRNDPPSRPSVHNLLQDDFFTCGYLPPRLPTTCLSIAPRFTPAL
LNSAQRKPLHDINNAGSTNSAAATLKCEPASQNDVESPDFHMDDLMKQLITLIDSNPSQR
RLIEMDEAEDPAANPVLWISKWVDYTDKYGLGYQLCDNSNGVLFNDCTRLLLYNNDEQIE
YIDKEMSESYHTLKSYPDTLTKKVTLLKYFRNYMSEHLLKAGANMAPKEGDQFSRLPFLR
TWFRTRSAIILHLSNGTLQINFFNDHTKIILCPLMGAVTYIDVTKKFCTYRLTQLQKHGC
CRELAHRLRYARTMLEKLISSRSTTVRQKDIA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgaaaagacatcccaatgaaagagattccagaaatactcaaagatgtttcaact
ggtaaaaaataccagcgaggacgttttcttggcaagggaggttttgcaaagtgctatgaa
attgtggatttggaaacgaaaaaaatatttgcaggaaaaattgtgccaaaggcgcttttg
gtaaaaccgcaccaaaaggataaaatggcacaagagatcacgttacatcgaagtgtctcg
catgaaaacgtcgttggttttcatggatttttcgaagattccgactttgtttatgttgtg
cttgagctatgcagaagaaggtcgctcatggagttgcacaaaaggcgaaaagctgtcacc
gagccagaagcgagatattacatgcgacaaattatcctcggtatgcaatacctgcattcc
aagaagataatacacagagacctgaagcttggcaatttgttcttgactgatgacatggag
ataaagattggagatctcgggctggctactcaagttgatttcgacggtgaacgtaagaaa
actttgtgtggaacacccaactatatcgcgcctgaggttctggggaagaagggacatagt
tacgaggtggatatctggtcactcggatgtatcatgtacaccttattaattggcaaacca
ccgttcgaaacaacttcattgaaggaaacttactcaagaatcaagaagaatgaatatcgt
attccaccgtctatttctccaatcgcaaggaaccttatcacaaagatgcttcgaaatgat
ccaccttctcgaccgtccgttcacaatttacttcaagatgatttcttcacgtgcggttac
ctcccaccacgcctcccaaccacttgtctctccatcgctccacgatttacaccggcactt
cttaactctgctcaacggaaaccactgcatgatattaacaacgctggttccaccaactct
gcagcagcgaccttgaaatgtgaacctgcttcacagaatgacgttgaatcaccagatttt
catatggatgatctaatgaaacaactcatcacgctcatagattccaacccatcacagcgg
agacttatcgaaatggatgaggcagaagacccggcagccaaccctgtgttgtggataagt
aaatgggtggattataccgacaaatatggactaggttaccagctatgtgacaacagcaat
ggtgttttattcaatgattgcacaagacttcttctttacaacaacgatgaacagattgaa
tacatagacaaggagatgagcgaatcttatcatacgttgaagtcctatcctgatacactt
acaaagaaagtcactctgcttaaatatttccgaaactacatgtcagaacatctgcttaag
gcgggagcaaacatggcccccaaggaaggcgatcaattttctcgcctcccgtttctccgc
acatggttccgcacgagaagtgccatcatcctccacctcagcaacggaaccttacagatc
aatttctttaacgaccacacaaaaatcattctgtgtccattgatgggtgctgttacatac
attgatgtcacgaaaaagttctgtacctaccgtttgacacaactacaaaaacacggttgt
tgtcgggagttggcccatcgactacgctatgcacgcacgatgctggaaaagctcatttcc
agtcgttctacaacagttagacaaaaagatattgcgtga

DBGET integrated database retrieval system